Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
Product Information
21295-1-AP targets SLC34A2 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15846 Product name: Recombinant human SLC34A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC146666 Sequence: MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLPSYSTATLIDEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLL Predict reactive species |
| Full Name | solute carrier family 34 (sodium phosphate), member 2 |
| Calculated Molecular Weight | 690 aa, 76 kDa |
| Observed Molecular Weight | 76 kDa |
| GenBank Accession Number | BC146666 |
| Gene Symbol | SLC34A2 |
| Gene ID (NCBI) | 10568 |
| RRID | AB_2878835 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95436 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC34A2, also known as NaPi-IIb, is a member of the solute carrier family 34 and encodes a type 2b sodium-dependent phosphate transporter. It is a multi-pass membrane protein composed of 690 amino acids. SLC34A2 is predominantly expressed in the lung, small intestine, and kidney. In the lung, it is specifically localized to the apical membrane of type II alveolar epithelial cells (ATII cells) and plays a crucial role during fetal lung development and embryonic development. It's reported that SLC34A2 is down-regulated in NSCLC tissues and cell lines. (PMID:26156586; 10329428)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC34A2 antibody 21295-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



