Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IP detected in | mouse heart tissue |
Positive IF-P detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 2 publications below |
Product Information
21848-1-AP targets CHT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16136 Product name: Recombinant human SLC5A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 457-580 aa of BC111525 Sequence: QPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ Predict reactive species |
Full Name | solute carrier family 5 (choline transporter), member 7 |
Calculated Molecular Weight | 580 aa, 63 kDa |
Observed Molecular Weight | 65-70 kDa |
GenBank Accession Number | BC111525 |
Gene Symbol | CHT1 |
Gene ID (NCBI) | 60482 |
RRID | AB_2878925 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9GZV3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CHT1 antibody 21848-1-AP | Download protocol |
IHC protocol for CHT1 antibody 21848-1-AP | Download protocol |
IF protocol for CHT1 antibody 21848-1-AP | Download protocol |
IP protocol for CHT1 antibody 21848-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Metab Activation of a non-neuronal cholinergic system in visceral white adipose tissue of obese mice and humans | ||
Adv Sci (Weinh) CircFBXW4 Suppresses Colorectal Cancer Progression by Regulating the MiR-338-5p/SLC5A7 Axis |