Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SLC6A8 Polyclonal antibody

SLC6A8 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 20299-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, ELISA

Creatine transporter 1, CRT, CRTR, CT1, Sodium- and chloride-dependent creatine transporter 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, HUVEC cells, mouse kidney tissue, rat heart tissue, rat kidney tissue
Positive IHC detected inmouse brain tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:300-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20299-1-AP targets SLC6A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14110

Product name: Recombinant human SLC6A8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 541-635 aa of BC012355

Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM

Predict reactive species
Full Name solute carrier family 6 (neurotransmitter transporter, creatine), member 8
Calculated Molecular Weight 635 aa, 71 kDa
Observed Molecular Weight 65-75 kDa
GenBank Accession NumberBC012355
Gene Symbol SLC6A8
Gene ID (NCBI) 6535
RRIDAB_2878665
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48029
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020). The 75 kDa band is a glycosylated modified form.

Protocols

Product Specific Protocols
IF protocol for SLC6A8 antibody 20299-1-APDownload protocol
IHC protocol for SLC6A8 antibody 20299-1-APDownload protocol
WB protocol for SLC6A8 antibody 20299-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Sci Adv

Glioblastoma exploits ATP from leading-edge astrocytes to fuel its infiltrative growth revealed by spatially resolved chimeric analysis

Authors - Gaoxia Yang
humanIHC

Front Oncol

Long Non-Coding RNA AL513318.2 as ceRNA Binding to hsa-miR-26a-5p Upregulates SLC6A8 Expression and Predicts Poor Prognosis in Non-Small Lung Cancer.

Authors - Yongfei Fan
mouseWB

J Agric Food Chem

Artepillin C, a key component of Brazilian propolis, induces thermogenesis in inguinal white adipose tissue of mice through a creatine metabolism-related thermogenic pathway.

Authors - Sho Nishikawa
humanWB,IHC

Ann Transl Med

SLC6A8 is involved in the progression of non-small cell lung cancer through the Notch signaling pathway.

Authors - Yan Feng
  • KD Validated
humanIHC

Front Genet

SLC6A8 is a Potential Biomarker for Poor Prognosis in Lung Adenocarcinoma.

Authors - Yongfei Fan
humanWB

Technol Cancer Res Treat

SLC6A8 Knockdown Suppresses the Invasion and Migration of Human Hepatocellular Carcinoma Huh-7 and Hep3B Cells.

Authors - Lu Yuan
  • KD Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Nusrat (Verified Customer) (12-12-2025)

The Ab works well with porcine and Rb cell lines.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human, Pig, Rabbit
Loading...
||
New chat

Able

正在加载,请稍候...