Tested Applications
| Positive WB detected in | human plasma, mouse kidney tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24584-1-AP targets SLCO4C1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20177 Product name: Recombinant human SLCO4C1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC152989 Sequence: MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG Predict reactive species |
| Full Name | solute carrier organic anion transporter family, member 4C1 |
| Calculated Molecular Weight | 724 aa, 79 kDa |
| Observed Molecular Weight | 60-85 kDa |
| GenBank Accession Number | BC152989 |
| Gene Symbol | SLCO4C1 |
| Gene ID (NCBI) | 353189 |
| RRID | AB_2879622 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZQN7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLCO4C1 is the only OATP ( organic anion transporting polypeptide) expressed at the human kidney's basolateral side of proximal tubular cells and mediates the excretion of uremic toxins (PMID: 21656517).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLCO4C1 antibody 24584-1-AP | Download protocol |
| WB protocol for SLCO4C1 antibody 24584-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLCO4C1 Polyclonal antibody (Cat# 24584-1-AP) has 9 citations published in journals including Cell Reports in Medicine, Journal of Ethnopharmacology, Frontiers in Cell and Developmental Biology, Oncology Reports, Drug Metabolism and Disposition, Biochemical and Biophysical Research Communications, Current Drug Metabolism, Aging, and World Journal of Gastrointestinal Pathophysiology. Research fields span diabetic kidney disease, hypertension, cancer (colon, endometrial, hepatocellular), drug transport/metabolism, and renal pharmacology.
| Species | Application | Title |
|---|---|---|
Cell Rep Med Phosphoglycerate kinase 1 contributes to diabetic kidney disease through enzyme-dependent and independent manners. | ||
Front Cell Dev Biol Identification and verification of a prognostic signature based on a miRNA-mRNA interaction pattern in colon adenocarcinoma | ||
Oncol Rep Knockdown of SLCO4C1 inhibits cell proliferation and metastasis in endometrial cancer through inactivating the PI3K/Akt signaling pathway.
| ||
Drug Metab Dispos High-Altitude Hypoxia Dysregulates the Organic Anion Transport Network to Alter Acetazolamide Disposition and Renal Metabolic Homeostasis: Validation of the Remote Sensing and Signaling Theory. | ||
