Tested Applications
| Positive WB detected in | A2780 cells, A549 cells, HL-60 cells |
| Positive IHC detected in | human skin tissue, human lung cancer tissue, human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2400 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14789-1-AP targets SNRPD2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6443 Product name: Recombinant human SNRPD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC000486 Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK Predict reactive species |
| Full Name | small nuclear ribonucleoprotein D2 polypeptide 16.5kDa |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14-16 kDa |
| GenBank Accession Number | BC000486 |
| Gene Symbol | SNRPD2 |
| Gene ID (NCBI) | 6633 |
| RRID | AB_10898359 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62316 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing, snRNP biogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SNRPD2 antibody 14789-1-AP | Download protocol |
| WB protocol for SNRPD2 antibody 14789-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cell Death Dis TRIM26-mediated NKRF degradation drives Osimertinib resistance through SNRPD2-dependent stress granule formation in lung adenocarcinoma. | ||
Autophagy Byakangelicin alleviates metabolic dysfunction-associated steatohepatitis by selective inhibition of a non-canonical MTORC1 signaling pathway. | ||
Adv Sci (Weinh) Dual Targeting of Mutant p53 and SNRPD2 via Engineered Exosomes Modulates Alternative Splicing to Suppress Ovarian Cancer. | ||
RNA Biol Nuclear retention element recruits U1 snRNP components to restrain spliced lncRNAs in the nucleus. | ||























