Tested Applications
Positive WB detected in | A2780 cells, A549 cells, HL-60 cells |
Positive IHC detected in | human skin tissue, human lung cancer tissue, human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2400 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
14789-1-AP targets SNRPD2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6443 Product name: Recombinant human SNRPD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC000486 Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK Predict reactive species |
Full Name | small nuclear ribonucleoprotein D2 polypeptide 16.5kDa |
Calculated Molecular Weight | 14 kDa |
Observed Molecular Weight | 14-16 kDa |
GenBank Accession Number | BC000486 |
Gene Symbol | SNRPD2 |
Gene ID (NCBI) | 6633 |
RRID | AB_10898359 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62316 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing, snRNP biogenesis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SNRPD2 antibody 14789-1-AP | Download protocol |
IHC protocol for SNRPD2 antibody 14789-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |