Tested Applications
| Positive WB detected in | human heart tissue, HeLa cells, HepG2 cells, MCF-7 cells, mouse kidney tissue, mouse liver tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
14977-1-AP targets SNRPF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6889 Product name: Recombinant human SNRPF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC002505 Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE Predict reactive species |
| Full Name | small nuclear ribonucleoprotein polypeptide F |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC002505 |
| Gene Symbol | SNRPF |
| Gene ID (NCBI) | 6636 |
| RRID | AB_2302166 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62306 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The 4 major small nuclear ribonucleoprotein particles (snRNPs), U1, U2, U4/U6, and U5, are essential components of the eukaryotic pre-mRNA splicing machinery. These snRNPs share 8 proteins which form the snRNP structural core: B/B-prime (SNRPB), D1 (SNRPD1), D2 (SNRPD2), D3 (SNRPD3), E (SNRPE), F (SNRPF), and G (SNRPG). These proteins have a role in the biogenesis of the snRNPs.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SNRPF antibody 14977-1-AP | Download protocol |
| IHC protocol for SNRPF antibody 14977-1-AP | Download protocol |
| WB protocol for SNRPF antibody 14977-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |























