Tested Applications
Positive IP detected in | mouse liver tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13062-1-AP targets SNX22 in IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3751 Product name: Recombinant human SNX22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC019655 Sequence: MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWG Predict reactive species |
Full Name | sorting nexin 22 |
Calculated Molecular Weight | 193 aa, 22 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC019655 |
Gene Symbol | SNX22 |
Gene ID (NCBI) | 79856 |
RRID | AB_2877909 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96L94 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sorting nexins (SNXs) are a large group of proteins that contain Phox (PX) domain and involve in regulating endocytosis and endosome sorting. SNX22 (sorting nexin 22) is a 193 amino acid protein that contains one phox domain and belongs to the SNX family.
Protocols
Product Specific Protocols | |
---|---|
IP protocol for SNX22 antibody 13062-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |