Tested Applications
| Positive IP detected in | mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13062-1-AP targets SNX22 in IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3751 Product name: Recombinant human SNX22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC019655 Sequence: MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWG Predict reactive species |
| Full Name | sorting nexin 22 |
| Calculated Molecular Weight | 193 aa, 22 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC019655 |
| Gene Symbol | SNX22 |
| Gene ID (NCBI) | 79856 |
| RRID | AB_2877909 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96L94 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sorting nexins (SNXs) are a large group of proteins that contain Phox (PX) domain and involve in regulating endocytosis and endosome sorting. SNX22 (sorting nexin 22) is a 193 amino acid protein that contains one phox domain and belongs to the SNX family.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for SNX22 antibody 13062-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

