Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
25763-1-AP targets SNX32 in WB, IP, IF, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22653 Product name: Recombinant human SNX32 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 218-285 aa of BC040981 Sequence: HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVVSDE Predict reactive species |
Full Name | sorting nexin 32 |
Calculated Molecular Weight | 46 kDa |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | BC040981 |
Gene Symbol | SNX32 |
Gene ID (NCBI) | 254122 |
RRID | AB_2880229 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86XE0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX32 (Sorting nexin-32, also known as SNX6B) may be involved in several stages of intracellular trafficking.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SNX32 antibody 25763-1-AP | Download protocol |
IHC protocol for SNX32 antibody 25763-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |