Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
25852-1-AP targets SOCS1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23119 Product name: Recombinant human SOCS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 119-211 aa of BC153088 Sequence: MASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI Predict reactive species |
Full Name | suppressor of cytokine signaling 1 |
Calculated Molecular Weight | 211 aa, 24 kDa |
GenBank Accession Number | BC153088 |
Gene Symbol | SOCS1 |
Gene ID (NCBI) | 8651 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O15524 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
Species | Application | Title |
---|---|---|
Front Mol Biosci Network-Based Expression Analyses and Experimental Verifications Reveal the Involvement of STUB1 in Acute Kidney Injury. | ||
Oncol Lett Knockdown of m6A methyltransferase METTL3 in gastric cancer cells results in suppression of cell proliferation. | ||
Cell Death Differ STING signaling remodels the tumor microenvironment by antagonizing myeloid-derived suppressor cell expansion. |