Tested Applications
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse embryo tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25415-1-AP targets SOX15 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22032 Product name: Recombinant human SOX15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 124-233 aa of BC000985 Sequence: AKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 15 |
| Calculated Molecular Weight | 25 kDa |
| GenBank Accession Number | BC000985 |
| Gene Symbol | SOX15 |
| Gene ID (NCBI) | 6665 |
| RRID | AB_2880067 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60248 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SOX15, also named as SOX12, SOX20, is a 223 amino acid protein, which contains one HMG box DNA-binding domain. SOX15 is widely expressed in fetal and adult tissues and highest level is found in fetal spinal cord and adult brain and testis. SOX15 is a candidate tumor suppressor in pancreatic cancer with a potential role in Wnt/β-catenin signaling. Sox15 is required for skeletal muscle regeneration and is up regulated in the embryonic mouse testis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SOX15 antibody 25415-1-AP | Download protocol |
| IHC protocol for SOX15 antibody 25415-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SOX15 antibody (Cat# 25415-1-AP) has 3 total citations. These appear in Oncogene, Journal of Biological Chemistry, and MicroPubl Biol. The research fields span glioma stem cell biology and ferroptosis regulation, stem cell pluripotency and neural differentiation, and antibody specificity validation in mouse embryos. Applications cited include Western blotting and immunofluorescence in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Oncogene CircVPS8 promotes the malignant phenotype and inhibits ferroptosis of glioma stem cells by acting as a scaffold for MKRN1, SOX15 and HNF4A | ||
J Biol Chem Transcription factor SOX15 regulates stem cell pluripotency and promotes neural fate during differentiation by activating the neurogenic gene Hes5
| ||
MicroPubl Biol A commonly used anti-SOX15 antibody fails to demonstrate specificity in mouse embryos |
