Tested Applications
Positive WB detected in | HEK-293 cells, mouse testis tissue |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21137-1-AP targets SPACA3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15589 Product name: Recombinant human SPACA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-123 aa of BC029867 Sequence: PYAGVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF Predict reactive species |
Full Name | sperm acrosome associated 3 |
Calculated Molecular Weight | 215 aa, 23 kDa |
Observed Molecular Weight | 28-32 kDa, 46-50 kDa |
GenBank Accession Number | BC029867 |
Gene Symbol | SPACA3 |
Gene ID (NCBI) | 124912 |
RRID | AB_10913810 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IXA5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SPACA3, also named as LYC3, LYZL3, SLLP1, SPRASA, CT54 and ALLP-17, belongs to the glycosyl hydrolase 22 family. It is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. SPACA3 has a Dimer form(PMID:15982649 ).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SPACA3 antibody 21137-1-AP | Download protocol |
IF protocol for SPACA3 antibody 21137-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |