• Featured Product
  • KD/KO Validated

SPARC Polyclonal antibody

SPARC Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15274-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig and More (2)

Applications

WB, IHC, IF, CoIP, ELISA

Basement membrane protein 40, Basement-membrane protein 40, BM 40, BM-40, ON

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, human testis tissue, ROS1728 cells, human placenta tissue
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15274-1-AP targets SPARC in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, deer, sika deer
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7390

Product name: Recombinant human SPARC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-303 aa of BC004974

Sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Predict reactive species
Full Name secreted protein, acidic, cysteine-rich (osteonectin)
Calculated Molecular Weight 35 kDa
Observed Molecular Weight35-43 kDa
GenBank Accession NumberBC004974
Gene Symbol SPARC
Gene ID (NCBI) 6678
RRIDAB_2194961
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09486
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Secreted Protein Acidic And Cysteine Rich (SPARC), also known as osteonectin or basement-membrane protein 40 (BM-40), is a secreted protein essential in the calcification of bone. 

What is the molecular weight of SPARC?

The calculated molecular mass of SPARC is 35 kDa. SPARC is a glycoprotein consisting of 303 amino acids in the cytoplasm and 286 amino acids after the signal sequence is cleaved in secretion. 

Where is SPARC expressed?

Osteoblasts secrete SPARC during bone formation, with high levels found in immature bone compared to mature bone that is in homeostasis (PMID: 2440898). SPARC is also secreted in adult mineralized tissues that have high turnover, such as osteoid and dentin, by cells other than osteoblasts. This includes bone marrow progenitor cells and hypertrophic chondrocytes but also endothelial cells and fibroblasts.

Though previously described as being exclusively expressed in mineralized tissue, it is now understood that SPARC is more widely expressed and is associated with high levels of collagen deposition, found in the extracellular matrix (ECM) of a number of tissues.

What is the function of SPARC?

SPARC contains both a collagen-binding domain and a hydroxyapatite (HA) binding region, so is thought to enhance mineralization by binding both collagen and HA crystals, causing the release of calcium ions (PMID: 26851678).

SPARC can bind to a number of different ECM proteins, particularly collagen, and may even influence the assembly of these proteins (PMID: 19798598). It is known to regulate interactions between cells and the ECM, meaning it plays a role in many important processes such as cell migration and proliferation.

What diseases are associated with SPARC?

Overexpression of SPARC has been identified in a number of different types of cancers (PMID: 18849185), although its role may vary. For example, in neuroblastomas SPARC acts as a suppressor but in gliomas, it causes greater invasion of the tumor. Mutations in SPARC can also lead to Osteogenesis Imperfecta, also known as brittle bone disease (PMID: 26027498).


Protocols

Product Specific Protocols
IHC protocol for SPARC antibody 15274-1-APDownload protocol
WB protocol for SPARC antibody 15274-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

ACS Appl Mater Interfaces

Evidence for Delivery of Abraxane via a Denatured-Albumin Transport System.

Authors - Maichi Hama
humanIHC

Cancer Discov

PMID: 22585996

Authors - Frese Kristopher K KK
humanWB,IF

Theranostics

A 9-kDa matricellular SPARC fragment released by cathepsin D exhibits pro-tumor activity in the triple-negative breast cancer microenvironment.

Authors - Lindsay B Alcaraz
ratIHC

Clin Cancer Res

The pancreas cancer microenvironment.

Authors - Feig Christine C
humanIF

Int J Cancer

Tissue-resident CXCR4+ macrophage as a poor prognosis signature promotes pancreatic ductal adenocarcinoma progression

Authors - Zhenyu Liao
humanWB

Int J Mol Sci

Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.

Authors - Federica Morani

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Víctor (Verified Customer) (11-03-2025)

The antibody appears to be quite specific and worked very well

  • Applications: Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Macrophages
SPARC Antibody Immunofluorescence,Cell culture validation (1:500 dilution) in Macrophages (Cat no:15274-1-AP)
FH

Susanne (Verified Customer) (11-19-2024)

works in human and mouse dermal fibroblasts

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: human and mouse dermal fibroblasts
SPARC Antibody Western Blot validation (1:1000 dilution) in human and mouse dermal fibroblasts (Cat no:15274-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...