Tested Applications
Positive WB detected in | HeLa cells, human skin tissue, PC-3 cells |
Positive IF/ICC detected in | BxPC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
Product Information
11847-1-AP targets SPCS1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2407 Product name: Recombinant human SPCS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC000884 Sequence: MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAK Predict reactive species |
Full Name | signal peptidase complex subunit 1 homolog (S. cerevisiae) |
Calculated Molecular Weight | 102 aa, 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC000884 |
Gene Symbol | SPCS1 |
Gene ID (NCBI) | 28972 |
RRID | AB_2195400 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y6A9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SPCS1 antibody 11847-1-AP | Download protocol |
IF protocol for SPCS1 antibody 11847-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nature A CRISPR screen defines a signal peptide processing pathway required by flaviviruses.
| ||
PLoS Pathog Signal Peptidase Complex Subunit 1 Participates in the Assembly of Hepatitis C Virus through an Interaction with E2 and NS2.
| ||
Mol Cell Cleavage of the pseudoprotease iRhom2 by the signal peptidase complex reveals an ER-to-nucleus signaling pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Joao (Verified Customer) (10-09-2019) | Specific, single band (~12kDa), low background
![]() |