Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SREBF2 Polyclonal antibody

SREBF2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 28212-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IP, CoIP, ELISA

bHLHd2, Class D basic helix-loop-helix protein 2, Processed sterol regulatory element-binding protein 2, SREBF 2, SREBP 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, HepG2 cells, PC-3 cells, HeLa cells
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28212-1-AP targets SREBF2 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, hamster, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28205

Product name: Recombinant human SREBF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 375-479 aa of BC056158

Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR

Predict reactive species
Full Name sterol regulatory element binding transcription factor 2
Calculated Molecular Weight 124 kDa
Observed Molecular Weight73-75 kDa, 120-130 kDa
GenBank Accession NumberBC056158
Gene Symbol SREBF2
Gene ID (NCBI) 6721
RRIDAB_2881091
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12772
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis. SREBF2 expression is dynamically regulated in response to nutritional and hormonal cues. SREBF2 exists two isoform with molecular weight 124 kDa and 73 kDa.

Protocols

Product Specific Protocols
IP protocol for SREBF2 antibody 28212-1-APDownload protocol
WB protocol for SREBF2 antibody 28212-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Nature

7-Dehydrocholesterol dictates ferroptosis sensitivity

Authors - Yaxu Li
HumanWB

Cancer Cell

Targeting the mevalonate pathway suppresses ARID1A-inactivated cancers by promoting pyroptosis

Authors - Wei Zhou
humanWB

Redox Biol

Lipophagy-mediated cholesterol synthesis inhibition is required for the survival of hepatocellular carcinoma under glutamine deprivation

Authors - Youzi Kong
  • KD Validated
humanWB

Hypertension

Statins Prevent the Deleterious Consequences of Placental Chemerin Upregulation in Preeclampsia

Authors - Lunbo Tan
mouseWB

Acta Pharmacol Sin

Urolithin A promotes atherosclerotic plaque stability by limiting inflammation and hypercholesteremia in Apolipoprotein E-deficient mice

Authors - Meng-Yun Xu
humanWB

Mol Metab

CD36 promotes de novo lipogenesis in hepatocytes through INSIG2-dependent SREBP1 processing.

Authors - Han Zeng

Reviews

    2.4 out of 5
Add a review

5 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Simon (Verified Customer) (07-23-2025)

The antibody works well for Jurkat cells, showin the precursor and the mature SREBF2

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: lymphoblasts (Jurkat cell line)
SREBF2 Antibody Western Blot validation (1:4000 dilution) in lymphoblasts (Jurkat cell line) (Cat no:28212-1-AP)

Shunbin (Verified Customer) (05-14-2024)

Not good. Only non specific bands detected

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: B cell lines
SREBF2 Antibody Western Blot validation (1:1000 dilution) in B cell lines (Cat no:28212-1-AP)

Shunbin (Verified Customer) (05-14-2024)

Many non specific bands, but no specific band can be identified

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
SREBF2 Antibody Western Blot validation (1:1000 dilution) in (Cat no:28212-1-AP)

Bertrand (Verified Customer) (04-08-2024)

This is a Srebp2 antibody, however, the results from western blot analysis show that the product might not be specific to Srebf2...There are lots of non-specific bands and the uncleaved/immature protein should not be present in the nucleus of cells, yet it was there.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Liver homogenates

Boyan (Verified Customer) (04-17-2023)

OK for WB, a specific but weak band was seen around 150 kd, but not 130 kd, which is shown on its booklet. The 130 kd band is a strong nonspecific band.

  • Applications: Western Blot
Loading...
||
New chat

Able

正在加载,请稍候...