• Featured Product
  • KD/KO Validated

ST6GAL1 Polyclonal antibody

ST6GAL1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14355-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Alpha 2,6-ST 1, B-cell antigen CD75, Beta-galactoside alpha-2,6-sialyltransferase 1, CD75, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HuH-7 cells, Jurkat cells, mouse spleen tissue, U-937 cells, L02 cells
Positive IP detected inRaji cells
Positive IHC detected inhuman colon cancer tissue, human ovary cancer tissue, human skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14355-1-AP targets ST6GAL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5705

Product name: Recombinant human ST6GAL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-406 aa of BC040009

Sequence: SQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Predict reactive species
Full Name ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 43-45 kDa, 50-70 kDa
GenBank Accession NumberBC040009
Gene Symbol ST6GAL1
Gene ID (NCBI) 6480
RRIDAB_2194422
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15907
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Western blot analysis of human liver using this antibody detects both isoforms between 43-50 kDa. Higher molecular weight of bands around 50-70 kDa can also be observed with glycosylation modification. (PMID: 15049997, 23358684)

Protocols

Product Specific Protocols
IHC protocol for ST6GAL1 antibody 14355-1-APDownload protocol
IP protocol for ST6GAL1 antibody 14355-1-APDownload protocol
WB protocol for ST6GAL1 antibody 14355-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF

Immunity

Immune checkpoint therapy-elicited sialylation of IgG antibodies impairs antitumorigenic type I interferon responses in hepatocellular carcinoma

Authors - Rui-Qi Wu
mouse,humanWB,IHC

Int J Cancer

Modification of α2,6-sialylation mediates the invasiveness and tumorigenicity of non-small cell lung cancer cells in vitro and in vivo via Notch1/Hes1/MMPs pathway.

Authors - Qingmin Yuan
  • KD Validated
mouse,humanIHC,IF

Mol Cell Proteomics

Integrated Systems Analysis of the Murine and Human Pancreatic Cancer Glycomes Reveals a Tumor-Promoting Role for ST6GAL1

Authors - Emma Kurz
  • KO Validated
humanWB

Front Oncol

High-Risk HPV16 E6 Activates the cGMP/PKG Pathway Through Glycosyltransferase ST6GAL1 in Cervical Cancer Cells.

Authors - Jun Wang
  • KD Validated
humanWB

Am J Cancer Res

α1,6-Fucosyltransferase (FUT8) regulates the cancer-promoting capacity of cancer-associated fibroblasts (CAFs) by modifying EGFR core fucosylation (CF) in non-small cell lung cancer (NSCLC).

Authors - Fengzhou Li
ratWB

Int J Food Sci Nutr

Ellagic acid alleviates TNBS-induced intestinal barrier dysfunction by regulating mucin secretion and maintaining tight junction integrity in rats

Authors - Bo Peng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (04-23-2024)

The strong band around 60 kd is a non-specific band. 1) This band doesn't respond to RNAi (I have another St6gal1 antibody which can confirm the RNAi was working), and 2) this band doesn't respond to PNGase deglycosylation (St6gal1 carries glycosylation, which should show a downshift after PNGase treatment).

  • Applications: Western Blot
FH

Vanessa (Verified Customer) (01-12-2024)

1:1000 dilution of the primary antibody accompanied by the recommended blocking, washing and incubation steps resulted in crisp bands with no background.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Jurkat cells
FH

Maggie (Verified Customer) (11-15-2023)

Overnight incubation

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: PC3 cells
ST6GAL1 Antibody Immunofluorescence validation (1:200 dilution) in PC3 cells (Cat no:14355-1-AP)
FH

Faezeh (Verified Customer) (01-29-2023)

It showed two bands in A549 and PANC1 cell lines, we validated that top band is the correct one using siRNA against ST6GAL1.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
ST6GAL1 Antibody Western Blot validation (1:1000 dilution) in (Cat no:14355-1-AP)
FH

Dawn (Verified Customer) (02-22-2022)

It is difficult to find good antibodies for glycoslytransferase genes, but this is a good one. It works in multiple cell lines as well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: A549 cells - lysate after miRNA transfection.
ST6GAL1 Antibody Western Blot validation (1:1000 dilution) in A549 cells - lysate after miRNA transfection. (Cat no:14355-1-AP)
FH

Patricia (Verified Customer) (02-25-2020)

Did not work- even for positive control

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Ovarian cancer
Loading...
||
New chat

Able

正在加载,请稍候...