Tested Applications
Positive WB detected in | U2OS cells, HEK-293 cells, mouse kidney tissue |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
20502-1-AP targets STARD3NL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14273 Product name: Recombinant human STARD3NL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 162-234 aa of BC005959 Sequence: ILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL Predict reactive species |
Full Name | STARD3 N-terminal like |
Calculated Molecular Weight | 234 aa, 27 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC005959 |
Gene Symbol | STARD3NL |
Gene ID (NCBI) | 83930 |
RRID | AB_10694281 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95772 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for STARD3NL antibody 20502-1-AP | Download protocol |
IHC protocol for STARD3NL antibody 20502-1-AP | Download protocol |
IF protocol for STARD3NL antibody 20502-1-AP | Download protocol |
IP protocol for STARD3NL antibody 20502-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Lianne (Verified Customer) (08-05-2025) | Fantastic antibody with a single clear band. Loved having the option to purchase a small, trial-size product, in order to test the antibody first.
![]() |