• Featured Product
  • KD/KO Validated

STK10 Polyclonal antibody

STK10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25471-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

EC:2.7.11.1, LOK, Lymphocyte oriented kinase, Lymphocyte-oriented kinase, PRO2729

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, A549 cells, COLO 320 cells
Positive IHC detected inhuman lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25471-1-AP targets STK10 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22169

Product name: Recombinant human STK10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 369-519 aa of BC070077

Sequence: SQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKD

Predict reactive species
Full Name serine/threonine kinase 10
Calculated Molecular Weight 968 aa, 112 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC070077
Gene Symbol STK10
Gene ID (NCBI) 6793
RRIDAB_2880096
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94804
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lymphocyte-oriented kinase deficiency encoded by the serine/threonine kinase 10 (STK10) gene correlates with the intracellular adhesion molecule 1 (ICAM-1)/lymphocyte function associated antigen 1 (LFA-1) complex in aspirin hypersensitivity(PMID:21905501). STK 10 is also named as LOK and expressed as a 130-kDa protein, which was detected predominantly in lymphoid organs such as spleen, thymus, and bone marrow, in contrast to other mammalian members of the STE20 family(PMID:9278426).

Protocols

Product Specific Protocols
WB protocol for STK10 antibody 25471-1-APDownload protocol
IHC protocol for STK10 antibody 25471-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Front Immunol

The enhancement of immunoactivity induced by immunogenic cell death through serine/threonine kinase 10 inhibition: a potential therapeutic strategy

Authors - Xiaoli Xia
  • KD Validated

Clin Cancer Res

Combined CDK4/6 and ERK1/2 inhibition enhances anti-tumor activity in NF1-associated plexiform neurofibroma

Authors - Alyssa C Flint

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jared (Verified Customer) (08-21-2019)

This antibody is an all-star antibody. I can even re use it a couple of times, and it still works. potent stuff. Picture would not upload... There is one strong band, and it shows virtually nothing in the lane where I CRISPR'd out LOK aka STK10 in the LOK band area. There is a non-specific band, but that is located clearly out of the range of where the LOK band is located. Non-specific band at approx 200kd. LOK for me runs at around 140kd.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: 293T and H1299
STK10 Antibody Western Blot, validation (1:3000 dilution) in 293T and H1299 (Cat no:25471-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...