Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SULT1A1 Monoclonal antibody

SULT1A1 Monoclonal Antibody for WB, ELISA

Cat No. 60076-1-Ig
Clone No. 10H6F6
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

EC:2.8.2.1, HAST1/HAST2, OK/SW-cl.88, P PST, P PST 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SULT1A1 in ?

Tested Applications

Positive WB detected inpig brain tissue, human placenta tissue, human liver tissue, Jurkat cells, U2OS cells, HepG2 cells, HEK-293 cells, rat brain tissue, mouse brain tissue, mouse liver tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:5000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60076-1-Ig targets SULT1A1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityrat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4611

Product name: Recombinant human SULT1A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-295 aa of BC000923

Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Predict reactive species
Full Name sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC000923
Gene Symbol SULT1A1
Gene ID (NCBI) 6817
RRIDAB_2197592
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50225
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SULT1A1, also named as ST1A1, P-PST 1, ST1A3, Ts-PST, P-PST 1, STP and STP1, belongs to the sulfotransferase 1 family. It catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A1 is also responsible for the sulfation and activation of minoxidil. It mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.

Protocols

Product Specific Protocols
WB protocol for SULT1A1 antibody 60076-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The SULT1A1 Monoclonal antibody (Cat# 60076-1-Ig) has 1 published citation. It appears in J Chromatogr B Analyt Technol Biomed Life Sci (2024), where it was used by Western blot to study the inhibitory effects of Huangkuisiwu formula on protein-binding uremic toxin biosynthesis in rats with chronic kidney disease. The research field encompasses nephrology, pharmacology, and analytical biochemistry.

SpeciesApplicationTitle
ratWB

J Chromatogr B Analyt Technol Biomed Life Sci

Liquid chromatography coupled with high resolution mass spectrometry reveals the inhibitory effects of Huangkuisiwu formula on biosynthesis of protein-binding uremic toxins in rats with chronic kidney disease

Authors - Jianping Li
Loading...
||
New chat

Able™

正在加载,请稍候...