Featured Product
KD/KO Validated

Sestrin 2 Polyclonal antibody

Sestrin 2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 10795-1-AP

Publications(243)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

Synonyms

SESN2, Sestrin2, EC:1.11.1.-, Hi95, Hypoxia-induced gene

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF-PIF/ICC

WB analysis using 10795-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10795-1-AP (Sestrin 2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 10795-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10795-1-AP (Sestrin 2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 10795-1-AP
WB result of Sestrin antibody (10795-1-AP, 1:2000) with si-Control and si-Sestrin transfected HEK293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 10795-1-AP
WB result of Sestrin 2 antibody (10795-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Sestrin 2 transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of NIH/3T3 using 10795-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10795-1-AP (Sestrin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human liver using 10795-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 10795-1-AP (Sestrin 2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human brain using 10795-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 10795-1-AP (Sestrin 2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat liver using 10795-1-AP
rat liver tissue were subjected to SDS PAGE followed by western blot with 10795-1-AP (Sestrin 2 antibody at dilution of 1:1000 incubated at 4 degree celsius over night.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of K-562 using 10795-1-AP
IP result of anti-Sestrin 2 (IP:10795-1-AP, 3ug; Detection:10795-1-AP 1:1000) with K-562 cells lysate 4000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10795-1-AP (Sestrin 2 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10795-1-AP (Sestrin 2 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10795-1-AP (Sestrin 2 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10795-1-AP (Sestrin 2 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 10795-1-AP (Sestrin 2 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 10795-1-AP (Sestrin 2 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10795-1-AP (Sestrin 2 antibody) at dilution of 1:50 (under 25x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10795-1-AP (Sestrin 2 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 10795-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10795-1-AP (Sestrin 2 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse kidney using 10795-1-AP
Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using Sestrin 2 antibody (10795-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 10795-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Sestrin 2 antibody (10795-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (243)
Protocols
Reviews (2)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, HeLa cells, human brain tissue, human liver tissue, NIH/3T3 cells, rat liver tissue, K-562 cells, mouse kidney tissue, A2780 cells, RAW 264.7 cells
Positive IP detected in	K-562 cells
Positive IHC detected in	human breast cancer tissue, human ovary tumor tissue, human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse kidney tissue
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:12000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:200-1:800
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10795-1-AP targets Sestrin 2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, rat, pig, bovine
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1247 Product name: Recombinant human Sestrin2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-480 aa of BC013304 Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT Predict reactive species
Full Name	sestrin 2
Calculated Molecular Weight	54 kDa
Observed Molecular Weight	54-60 kDa
GenBank Accession Number	BC013304
Gene Symbol	SESN2/Sestrin 2
Gene ID (NCBI)	83667
RRID	AB_2185480
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P58004
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SESN is a family of highly conserved, stress-inducible genes that can defend the cell against oxidative damage and oncogenic signaling. SESN2 ,which belongs to the SESN family, has been implicated as a tumor suppressor that can inhibit angiogenesis and promote autophagy, underscoring the importance of elucidating the molecular mechanism by which SESN2 regulates pathways of metabolism and survival.(PMID:22363791). Sesn2 encodes a 480 amino acid protein which can run as a 60 kDa band on SDS-polyacrylamide gel electrophoresis(PMID:20878915).

Protocols

Product Specific Protocols
IF protocol for Sestrin 2 antibody 10795-1-AP	Download protocol
IHC protocol for Sestrin 2 antibody 10795-1-AP	Download protocol
IP protocol for Sestrin 2 antibody 10795-1-AP	Download protocol
WB protocol for Sestrin 2 antibody 10795-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Nature Stem cell function and stress response are controlled by protein synthesis. Authors - Sandra Blanco View Article
human	WB	Nature Systematic quantitative analysis of ribosome inventory during nutrient stress. Authors - Heeseon An View Article
mouse	WB	Nature SAR1B senses leucine levels to regulate mTORC1 signalling. Authors - Jie Chen View Article
mouse	WB	Science Zonated leucine sensing by Sestrin-mTORC1 in the liver controls the response to dietary leucine. Authors - Andrew L Cangelosi View Article
human	WB	Nature SZT2 dictates GATOR control of mTORC1 signalling. Authors - Min Peng View Article
mouse	WB	Cell Sestrins Function as Guanine Nucleotide Dissociation Inhibitors for Rag GTPases to Control mTORC1 Signaling. Authors - Min Peng KO Validated View Article

Reviews

4.5 out of 5

Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Ashish (Verified Customer) (01-04-2022)	This is very good antibody for western blotting , even works good for IHC Applications: Western Blot, Immunohistochemistry, Immunoprecipitation Primary Antibody Dilution: 1:3000 Cell Tissue Type: HeK293T , HeLA
H (Verified Customer) (04-05-2020)	This antibody works very well and very sensitive. I always get a specific and thick band. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: HEK293T Sestrin 2 Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:10795-1-AP)