Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Sestrin 2 Monoclonal antibody

Sestrin 2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66297-1-Ig
Clone No.1A1A4

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

HI95, SES2, SESN2, SEST2, sestrin 2, Sestrin2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293T
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66297-1-Ig targets Sestrin 2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rat samples.

Tested Reactivity human, pig, rat
Cited Reactivityhuman, mouse, rat, pig, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20638

Product name: Recombinant human Sestrin2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 132-480 aa of BC013304

Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT

Predict reactive species
Full Name sestrin 2
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 54 kDa
GenBank Accession NumberBC013304
Gene Symbol SESN2/Sestrin 2
Gene ID (NCBI) 83667
RRIDAB_2881680
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP58004
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 2 is implicated in the regulation of cell survival, in cellular responses to different stress conditions, and also acts as a positive regulator of autophagy. Sestrin 2 is approximately a 57.6kDa protein (480 amino acids).

Protocols

Product Specific Protocols
IF protocol for Sestrin 2 antibody 66297-1-IgDownload protocol
IHC protocol for Sestrin 2 antibody 66297-1-IgDownload protocol
WB protocol for Sestrin 2 antibody 66297-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
human,mouseWB,IF

Cell Biol Toxicol

Induction of Sestrin2 by pterostilbene suppresses ethanol-triggered hepatocyte senescence by degrading CCN1 via p62-dependent selective autophagy.

Authors - Yiming Jiang
  • KD Validated

Front Cell Dev Biol

Histone Demethylase JMJD3 Mediated Doxorubicin-Induced Cardiomyopathy by Suppressing SESN2 Expression.

Authors - Panxia Wang
humanWB,IHC

Osteoarthritis Cartilage

Suppression of Sestrins in aging and osteoarthritic cartilage: dysfunction of an important stress defense mechanism.

Authors - T Shen
pigWB, IP

J Nutr

Intermittent Bolus Compared With Continuous Feeding Enhances Insulin and Amino Acid Signaling to Translation Initiation in Skeletal Muscle of Neonatal Pigs.

Authors - Agus Suryawan
human,mouseWB,IHC,IF,IP

Cell Tissue Res

Sestrin2 attenuates renal damage by regulating Hippo pathway in diabetic nephropathy.

Authors - Yawei Bian
pigWB

Am J Physiol Endocrinol Metab

Prematurity blunts the insulin- and amino acid-induced stimulation of translation initiation and protein synthesis in skeletal muscle of neonatal pigs.

Authors - Marko Rudar

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Yahir Alberto (Verified Customer) (11-12-2021)

This antibody works nicely for western blotting, although with several unspecific bands for a monoclonal antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK 293T cells
Sestrin 2 Antibody Western Blot validation (1:1000 dilution) in HEK 293T cells (Cat no:66297-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...