Tested Applications
| Positive WB detected in | mouse colon tissue, mouse stomach tissue, rat colon tissue, rat stomach tissue |
| Positive IHC detected in | mouse brain tissue, human colon cancer tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF-Fro detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10493-1-AP targets transgelin/SM22 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0764 Product name: Recombinant human TAGLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC004927 Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Predict reactive species |
| Full Name | transgelin |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 19-22 kDa |
| GenBank Accession Number | BC004927 |
| Gene Symbol | transgelin/SM22 |
| Gene ID (NCBI) | 6876 |
| RRID | AB_2199363 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01995 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The transgelin family is a protein group belonging to the 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, or SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full-length transgelin 1 protein. It can cross-react with other two transgenes based on the sequence similarity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for transgelin/SM22 antibody 10493-1-AP | Download protocol |
| IHC protocol for transgelin/SM22 antibody 10493-1-AP | Download protocol |
| WB protocol for transgelin/SM22 antibody 10493-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Transgelin (TAGLN) antibody (Cat# 10493-1-AP) has accumulated 232 total citations published in high-impact journals including Nature Communications, Cell, Cancer Cell, Circulation Research, Atherosclerosis, Free Radical Biology and Medicine, FASEB Journal, Redox Biology, and Theranostics. Research fields are predominantly cardiovascular biology—encompassing atherosclerosis, vascular calcification, aortic aneurysm/dissection, pulmonary hypertension, and neointimal hyperplasia—along with oncology, immunology/inflammation, regenerative medicine/biomaterials, and developmental biology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Macropinocytosis maintains CAF subtype identity under metabolic stress in pancreatic cancer | ||
Adv Mater Safeguarding VSMC Contractile Phenotype With In Situ circRNA-mediated Endothelial Olaratumab Engineering to Prevent Vascular Graft Stenosis. | ||
Bioact Mater A TEMPOL and rapamycin loaded nanofiber-covered stent favors endothelialization and mitigates neointimal hyperplasia and local inflammation. | ||
Bioact Mater TLR2 inhibition attenuates NET-driven inflammation and restenosis during poly-lactic acid bioresorbable scaffold degradation. | ||
Bioact Mater M1 macrophage-derived exosomal miR-155-5p exacerbates aortic dissection via SMAD5-Mediated regulation of vascular smooth muscle cell phenotype. |
Reviews
What customers say
The single review for 10493-1-AP is from Ying Tian (2019), who used it at a 1:1000 dilution for Western Blot on primary mouse cardiomyocytes (lot 00005183). She rated it 4 out of 5 stars and described it as a "very good antibody." Overall, the limited feedback is positive, with no reported issues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ying (Verified Customer) (08-19-2019) | very good antibody
|
