Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

transgelin/SM22 Polyclonal antibody

transgelin/SM22 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IF-Fro, IP, ELISA

SM22, transgelin, 22 kDa actin-binding protein, Protein WS3-10, SM22-a

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for transgelin/SM22 in ?

Tested Applications

Positive WB detected inmouse colon tissue, mouse stomach tissue, rat colon tissue, rat stomach tissue
Positive IHC detected inmouse brain tissue, human colon cancer tissue, mouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive IF-Fro detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10493-1-AP targets transgelin/SM22 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0764

Product name: Recombinant human TAGLN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC004927

Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Predict reactive species
Full Name transgelin
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 19-22 kDa
GenBank Accession NumberBC004927
Gene Symbol transgelin/SM22
Gene ID (NCBI) 6876
RRIDAB_2199363
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01995
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The transgelin family is a protein group belonging to the 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, or SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full-length transgelin 1 protein. It can cross-react with other two transgenes based on the sequence similarity.

Protocols

Product Specific Protocols
IF protocol for transgelin/SM22 antibody 10493-1-APDownload protocol
IHC protocol for transgelin/SM22 antibody 10493-1-APDownload protocol
WB protocol for transgelin/SM22 antibody 10493-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-Transgelin (TAGLN) antibody (Cat# 10493-1-AP) has accumulated 232 total citations published in high-impact journals including Nature Communications, Cell, Cancer Cell, Circulation Research, Atherosclerosis, Free Radical Biology and Medicine, FASEB Journal, Redox Biology, and Theranostics. Research fields are predominantly cardiovascular biology—encompassing atherosclerosis, vascular calcification, aortic aneurysm/dissection, pulmonary hypertension, and neointimal hyperplasia—along with oncology, immunology/inflammation, regenerative medicine/biomaterials, and developmental biology.

SpeciesApplicationTitle
mouseIHC

Cancer Cell

Macropinocytosis maintains CAF subtype identity under metabolic stress in pancreatic cancer

Authors - Yijuan Zhang
mouseIF

Cell

Mapping the Fine-Scale Organization and Plasticity of the Brain Vasculature.

Authors - Christoph Kirst
ratIF

Adv Mater

Safeguarding VSMC Contractile Phenotype With In Situ circRNA-mediated Endothelial Olaratumab Engineering to Prevent Vascular Graft Stenosis.

Authors - Shunqi Hu
humanWB

Bioact Mater

A TEMPOL and rapamycin loaded nanofiber-covered stent favors endothelialization and mitigates neointimal hyperplasia and local inflammation.

Authors - Rui Wang

Bioact Mater

TLR2 inhibition attenuates NET-driven inflammation and restenosis during poly-lactic acid bioresorbable scaffold degradation.

Authors - Changyi Zhou

Bioact Mater

M1 macrophage-derived exosomal miR-155-5p exacerbates aortic dissection via SMAD5-Mediated regulation of vascular smooth muscle cell phenotype.

Authors - Dengwei Cao

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 10493-1-AP is from Ying Tian (2019), who used it at a 1:1000 dilution for Western Blot on primary mouse cardiomyocytes (lot 00005183). She rated it 4 out of 5 stars and described it as a "very good antibody." Overall, the limited feedback is positive, with no reported issues.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ying (Verified Customer) (08-19-2019)

very good antibody

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: primary mouse cardiomyocytes
Loading...
||
New chat

Able™

正在加载,请稍候...