TANK Polyclonal antibody

TANK Polyclonal Antibody for WB, ELISA

Cat No. 27065-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

I TRAF, ITRAF, I-TRAF, TRAF family member-associated NF-kappa-B activator, TRAF interacting protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis of HepG2 using 27065-1-AP
WB result of TANK antibody (27065-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-TANK transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of THP-1 using 27065-1-AP
THP-1 cells were subjected to SDS PAGE followed by western blot with 27065-1-AP (TANK Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 27065-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 27065-1-AP (TANK Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 27065-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 27065-1-AP (TANK Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in

THP-1 cells, HepG2 cells

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

27065-1-AP targets TANK in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag25740 Product name: Recombinant human TANK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003388 Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI Predict reactive species
Full Name	TRAF family member-associated NFKB activator
Calculated Molecular Weight	14 kDa
Observed Molecular Weight	48 kDa
GenBank Accession Number	BC003388
Gene Symbol	TANK
Gene ID (NCBI)	10010
RRID	AB_2880738
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92844
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
WB protocol for TANK antibody 27065-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
human	WB	Cancer Res FIP200 suppresses immune checkpoint therapy responses in breast cancers by limiting AZI2/TBK1/IRF signaling independent of its canonical autophagy function. Authors - Takako Okamoto View Article
		Front Cell Infect Microbiol Porcine Sapelovirus 3Cpro Inhibits the Production of Type I Interferon. Authors - Mengge Yin View Article
rat	WB	Int Immunopharmacol The effect of Astragaloside IV on ethanol-induced gastric mucosal injury in rats: Involvement of inflammation. Authors - Shumin Qin View Article
human	WB	J Mol Cell Biol TRIM14 promotes endothelial activation via activating NF-κB signaling pathway. Authors - Xuan Huang View Article
human	WB	Biomolecules Paraoxonase 1 Suppresses Hepatocellular Carcinoma Progression by Modulating the NOD-like Receptor Signaling Pathway. Authors - Hao-Lin Wei View Article