Filter: AllWBIPIHCIF/ICC

WB analysis of HEK-293 using 17002-1-AP
WB result of TBC1D23 antibody (17002-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TBC1D23 transfected HEK-293 cells.
WB analysis of HepG2 using 17002-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 17002-1-AP (TBC1D23 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 17002-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 17002-1-AP (TBC1D23 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IP experiment of HepG2 using 17002-1-AP
IP result of anti-TBC1D23 (IP:17002-1-AP, 4ug; Detection:17002-1-AP 1:500) with HepG2 cells lysate 2400ug.
IHC staining of human liver using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human liver using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human stomach cancer using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 17002-1-AP (TBC1D23 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human kidney using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human kidney using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human testis using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human testis using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human spleen using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human ovary using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human ovary using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human spleen using 17002-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 17002-1-AP (TBC1D23 antibody) at dilution of 1:100 (under 40x lens).
IF Staining of HeLa using 17002-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 17002-1-AP (TBC1D23 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Featured Product
KD/KO Validated

TBC1D23 Polyclonal antibody

TBC1D23 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17002-1-AP

Publications(7)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HCV non-structural protein 4A-transactivated protein 1, NS4ATP1, TBC1 domain family member 23, TBC1 domain family, member 23

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (7)
Protocols
Reviews (3)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HepG2 cells, HEK-293 cells, HeLa cells
Positive IP detected in	HepG2 cells
Positive IHC detected in	human stomach cancer tissue, human kidney tissue, human liver tissue, human ovary tissue, human spleen tissue, human testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:100-1:1000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 6 publications below
IHC	See 2 publications below
IF	See 3 publications below

Product Information

17002-1-AP targets TBC1D23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag10697 Product name: Recombinant human TBC1D23 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC010221 Sequence: MLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHLLVTATHMYCLREIVSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES Predict reactive species
Full Name	TBC1 domain family, member 23
Calculated Molecular Weight	699 aa, 78 kDa
Observed Molecular Weight	70-78 kDa
GenBank Accession Number	BC010221
Gene Symbol	TBC1D23
Gene ID (NCBI)	55773
RRID	AB_2240206
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NUY8
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBC1D23, also named as NS4ATP1, is a gene down-regulated by Pneumocystis infection. Pneumocystis pneumonia is a common opportunistic disease in AIDS patients. (PMID: 20377877) Recently it has been found that TBC1D23 gene is the most frequently mutated in MSI-H cell lines and protein expressions of TBC1D23 in tumors with mutation were down regulated.(PMID: 20824714) This antibody is specific to TBC1D23.

Protocols

Product Specific Protocols
IF protocol for TBC1D23 antibody 17002-1-AP	Download protocol
IHC protocol for TBC1D23 antibody 17002-1-AP	Download protocol
IP protocol for TBC1D23 antibody 17002-1-AP	Download protocol
WB protocol for TBC1D23 antibody 17002-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Cell The WDR11 complex is a receptor for acidic-cluster-containing cargo proteins Authors - Huaqing Deng View Article
	WB	Nat Commun TBC1D23 mediates Golgi-specific LKB1 signaling Authors - Yingfeng Tu View Article
human	WB,IF	Am J Hum Genet Homozygous Mutations in TBC1D23 Lead to a Non-degenerative Form of Pontocerebellar Hypoplasia. Authors - Isaac Marin-Valencia View Article
human	IF	Am J Hum Genet Homozygous Truncating Variants in TBC1D23 Cause Pontocerebellar Hypoplasia and Alter Cortical Development. Authors - Ekaterina L Ivanova View Article
human	WB,IHC	Int J Cancer Identification of frequently mutated genes with relevance to nonsense mediated mRNA decay in the high microsatellite instability cancers. Authors - Shin Nara N View Article
human	WB,IHC,IF	J Cell Mol Med TBC1 domain family member 23 interacts with Ras-related protein Rab-11A to promote poor prognosis of non-small-cell lung cancer via β1-integrin. Authors - Yao Zhang View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Ioana (Verified Customer) (08-28-2025)	This antibody works well in Western Blotting. Band size is what I had expected, but it is a little faint. Applications: Western Blot Primary Antibody Dilution: 1:250 Cell Tissue Type: HeLaM
FH Christine (Verified Customer) (01-27-2023)	Main band detected below the 85 kDa marker (expected size of TBC1D23 is 78, observed is 70-78). Applications: Western Blot Primary Antibody Dilution: 1:1,000 Cell Tissue Type: HEK293T
FH Jerome (Verified Customer) (05-22-2019)	Most cells show the expected Golgi localisation; but not all. High background Applications: Immunofluorescence, Primary Antibody Dilution: 1:100 Cell Tissue Type: HeLa cells TBC1D23 Antibody Immunofluorescence, validation (1:100 dilution) in HeLa cells (Cat no:17002-1-AP)