• Featured Product
  • KD/KO Validated

TBC1D5 Polyclonal antibody

TBC1D5 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 17078-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

KIAA0210, TBC1 domain family member 5, TBC1 domain family, member 5

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HEK-293T cells, Jurkat cells, PC-3 cells
Positive IP detected inJurkat cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17078-1-AP targets TBC1D5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10991

Product name: Recombinant human TBC1D5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 445-795 aa of BC013145

Sequence: TNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI

Predict reactive species
Full Name TBC1 domain family, member 5
Calculated Molecular Weight 795 aa, 89 kDa
Observed Molecular Weight 89 kDa
GenBank Accession NumberBC013145
Gene Symbol TBC1D5
Gene ID (NCBI) 9779
RRIDAB_2199389
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92609
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBC1D5, a member of TBC (Tre2/Bub2/Cdc16)1 domain family, is a novel retromer-interacting protein. TBC1D5 is a Rab GTPase-activating proteins (GAPs) proteins that negatively regulates VPS35/29/26 recruitment and causes Rab7 to dissociate from the membrane. TBC1D5 could bridge the endosome and autophagosome via its C-terminal LIR motif, and Rab GAPs are implicated in the reprogramming of the endocytic trafficking events under starvation-induced autophagy. The TBC1D5 protein exists 89 kDa and 91 kDa isoforms.

Protocols

Product Specific Protocols
WB protocol for TBC1D5 antibody 17078-1-APDownload protocol
IHC protocol for TBC1D5 antibody 17078-1-APDownload protocol
IP protocol for TBC1D5 antibody 17078-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Sci Adv

De novo macrocyclic peptides for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex.

Authors - Kai-En Chen
humanWB

EMBO J

Control of RAB7 activity and localization through the retromer-TBC1D5 complex enables RAB7-dependent mitophagy.

Authors - Ana Jimenez-Orgaz
  • KO Validated
humanWB

J Cell Biol

Retromer and TBC1D5 maintain late endosomal RAB7 domains to enable amino acid-induced mTORC1 signaling.

Authors - Arunas Kvainickas
  • KO Validated
WB

EMBO Rep

BioID reveals an ATG9A interaction with ATG13-ATG101 in the degradation of p62/SQSTM1-ubiquitin clusters.

Authors - Ashari R Kannangara
humanWB

Int J Biol Sci

TBK1 Facilitates GLUT1-Dependent Glucose Consumption by suppressing mTORC1 Signaling in Colorectal Cancer Progression.

Authors - Diyuan Zhou
  • KD Validated
mouseIF

Mol Biol Cell

Trafficking defects in WASH-knockout fibroblasts originate from collapsed endosomal and lysosomal networks.

Authors - Gomez Timothy S TS

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

q (Verified Customer) (06-01-2021)

It is OK to detect TBC1D5 (100 kD) in both mouse and postmortem brain lysates, although there are some non specific bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mouse brain and postmortembrain lysates
TBC1D5 Antibody Western Blot validation (1:3000 dilution) in mouse brain and postmortembrain lysates (Cat no:17078-1-AP)
FH

Florian (Verified Customer) (04-09-2019)

This is a very strong antibody that is reasonably specific in western blot applications. We have validated it through Crispr/Cas9 mediated knockout of TBC1D5 in HeLa cells (Jimenez-Orgaz et al, EMBOJ, 2018). While the strongest band is indeed TBC1D5, as our knockout confirms, it also produces several weaker, unspecific bands on membranes blocked with 5% milk. Because of the unspecific bands, I rate it with four stars instead of five. We have not tested it for immunofluorescence. Overall, it is a very good antibody that will probably also work at much lower dilutions than 1:1000. Diluting it further may also reduce the unspecific signal.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hela cells
FH

David (Verified Customer) (02-28-2019)

Hela cells stained with anti-TBC1D5 (green) and Hoechst (blue)

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Hela cells
TBC1D5 Antibody Western Blot,Immunofluorescence, validation (1:200 dilution) in Hela cells (Cat no:17078-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...