Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
18951-1-AP targets TBRG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4346 Product name: Recombinant human TBRG1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-123 aa of BC032312 Sequence: MSLLDGLASSPRAPLQSSKARMKKLPKKSQNEKYRLKYLRLRKAAKATVFVSLTHVQPVPSWRLPHKIFPQAVPPSQCDSINTVLAFPYTLLLVSLVSLDKLRNFSVSSSVNELVTVLQNNEY Predict reactive species |
| Full Name | transforming growth factor beta regulator 1 |
| Calculated Molecular Weight | 45 kDa |
| GenBank Accession Number | BC032312 |
| Gene Symbol | TBRG1 |
| Gene ID (NCBI) | 84897 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q3YBR2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
