Featured Product
KD/KO Validated

TCF1/TCF7 Polyclonal antibody

TCF1/TCF7 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 14464-1-AP

Publications(29)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

TCF7, T cell factor 1, TCF 1, TCF 7, TCF1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-P

WB analysis of mouse thymus using 14464-1-AP
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14464-1-AP (TCF7 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse spleen using 14464-1-AP
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 14464-1-AP (TCF1/TCF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse spleen using 14464-1-AP
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 14464-1-AP (TCF1/TCF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 14464-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14464-1-AP (TCF7 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 14464-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14464-1-AP (TCF7 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 14464-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 14464-1-AP (TCF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 14464-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 14464-1-AP (TCF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse spleen using 14464-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using TCF1/TCF7 antibody (14464-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 14464-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using TCF1/TCF7 antibody (14464-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 14464-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using TCF1/TCF7 antibody (14464-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (29)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse thymus tissue
Positive IHC detected in	mouse spleen tissue, human lymphoma tissue, human tonsillitis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse spleen tissue, human tonsillitis tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14464-1-AP targets TCF1/TCF7 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, bovine
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5792 Product name: Recombinant human TCF7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-384 aa of BC048769 Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL Predict reactive species
Full Name	transcription factor 7 (T-cell specific, HMG-box)
Calculated Molecular Weight	42 kDa
Observed Molecular Weight	43 kDa
GenBank Accession Number	BC048769
Gene Symbol	TCF1/TCF7
Gene ID (NCBI)	6932
ENSEMBL Gene ID	ENSG00000081059
RRID	AB_2878061
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P36402
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCF7, also known as TCF1, belongs to the TCF/LEF family. TCF7 is part of the Wnt signaling pathway and plays an important role in the differentiation and self-renewal of memory T cells. It has been found that TCF7 is necessary to revive T cells in response to PD-1 blockade against viral infection or cancer. TCF7 is mainly expressed in T-cells and is also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. TCF7 has 16 isoforms with the molecular mass of 28-54 kDa (PMID: 34044317).

Protocols

Product Specific Protocols
IF protocol for TCF1/TCF7 antibody 14464-1-AP	Download protocol
IHC protocol for TCF1/TCF7 antibody 14464-1-AP	Download protocol
WB protocol for TCF1/TCF7 antibody 14464-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
mouse	WB	Cell Mol Immunol TRIM27 maintains gut homeostasis by promoting intestinal stem cell self-renewal Authors - Jing Wang View Article
human	WB,IHC	Clin Cancer Res Single-Cell Analyses Reveal Mechanisms of Cancer Stem Cell Maintenance and Epithelial-Mesenchymal Transition in Recurrent Bladder Cancer. Authors - Huanjun Wang KD Validated View Article
mouse,human	WB	Int J Biol Macromol Correlation between TCF7 and bladder cancer and feasibility of Erlotinib targeting in bladder cancer: Molecular mechanism and expression of TCF7 recombinant protein Authors - Zengmi Mo View Article
human	WB	Clin Transl Med Long noncoding RNA LINC01606 protects colon cancer cells from ferroptotic cell death and promotes stemness by SCD1-Wnt/β-catenin-TFE3 feedback loop signalling. Authors - Yajun Luo View Article
mouse	WB	iScience Suppression of preadipocyte determination by SOX4 limits white adipocyte hyperplasia in obesity Authors - Ting He View Article
human	WB	J Transl Med Forkhead Box S1 mediates epithelial-mesenchymal transition through the Wnt/β-catenin signaling pathway to regulate colorectal cancer progression. Authors - Liang Zhang View Article