Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TDO2 Polyclonal antibody

TDO2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15880-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Tryptamin 2,3 dioxygenase, TRPO, TPH2, TO, TDO

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue
Positive IHC detected inhuman liver cancer tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15880-1-AP targets TDO2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8642

Product name: Recombinant human TDO2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 55-406 aa of BC005355

Sequence: QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Predict reactive species
Full Name tryptophan 2,3-dioxygenase
Calculated Molecular Weight 406 aa, 48 kDa
Observed Molecular Weight 40-50 kDa
GenBank Accession NumberBC005355
Gene Symbol TDO2
Gene ID (NCBI) 6999
RRIDAB_2827610
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48775
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TDO2 (tryptophan 2,3-dioxygenase), IDO1 (indoleamine 2,3-dioxygenase 1) and IDO2 are three enzymes that catalyze the amino acid tryptophan into kynurenine in the kynurenine pathway (PMID: 23090118, 28469468). TDO2 plays an important role in neurological diseases such as Alzheimer's disease, Parkinson's disease and autism. Overexpression of TDO2 promoted tumor cell survival and was correlated with tumor grade and poor prognosis in triple negative breast cancer, brain tumors and esophageal squamous cell carcinoma. TDO2 may be a potential therapeutic target in some cancers. (PMID: 21976023, 30134247)

Protocols

Product Specific Protocols
IF protocol for TDO2 antibody 15880-1-APDownload protocol
IHC protocol for TDO2 antibody 15880-1-APDownload protocol
WB protocol for TDO2 antibody 15880-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
human, mouseWB

Cancer Cell

Inhibition of De Novo NAD(+) Synthesis by Oncogenic URI Causes Liver Tumorigenesis through DNA Damage.

Authors - Krishna S Tummala
  • KD Validated
humanWB

Nat Commun

Engineered MED12 mutations drive leiomyoma-like transcriptional and metabolic programs by altering the 3D genome compartmentalization

Authors - Kadir Buyukcelebi
humanWB

ACS Appl Mater Interfaces

Reprogrammed IDO-Induced Immunosuppressive Microenvironment Synergizes with Immunogenic Magnetothermodynamics for Improved Cancer Therapy

Authors - Xun Wang
human,ratWB,IHC,IF

Br J Pharmacol

Tryptophan 2,3-dioxygenase 2 plays a key role in regulating the activation of fibroblast-like synoviocytes in autoimmune arthritis.

Authors - Yan Chang
  • KD Validated
mouseWB

Front Immunol

DSS-induced colitis activates the kynurenine pathway in serum and brain by affecting IDO-1 and gut microbiota

Authors - Li-Ping Zhao
humanWB,IHC

Fertil Steril

Tryptophan catabolism is dysregulated in leiomyomas.

Authors - Tsai-Der Chuang

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hala (Verified Customer) (03-10-2021)

works veryyy gooddd

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000 - 1/2000
  • Cell Tissue Type: hepatoblastoma cells transduced with lentivirus expressing TDO2

Hala (Verified Customer) (12-15-2020)

so efficient

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/750 - 1/1000
  • Cell Tissue Type: liver cells transduced with lentivirus expressing TDO2
TDO2 Antibody Western Blot validation (1/750 - 1/1000 dilution) in liver cells transduced with lentivirus expressing TDO2 (Cat no:15880-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...