Tested Applications
Positive IHC detected in | human colon tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 3 publications below |
IF | See 1 publications below |
Product Information
23277-1-AP targets Trefoil factor 3 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9543 Product name: Recombinant human TFF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC017859 Sequence: MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF Predict reactive species |
Full Name | trefoil factor 3 (intestinal) |
Calculated Molecular Weight | 80 aa, 9 kDa |
GenBank Accession Number | BC017859 |
Gene Symbol | TFF3 |
Gene ID (NCBI) | 7033 |
RRID | AB_2879245 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q07654 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Trefoil factor 3 (TFF3) belongs to the TFF-domain peptide family which consists of three small secreted proteins (TFF1, TFF2, TFF3) that are expressed by mucous-secreting epithelia. TFF3 is a major constituent in the goblet cells in small and large intestines, especially a typical secretary peptide of the normal human antral and pyloric gastric mucosa. TFF3 is essential in regulating cell migration and maintaining normal GI mucosal integrity. TFF3 has been reported to be overexpressed at the gene and the protein level in human neoplasms such as prostate, breast, and colon cancer. TFF3 is involved in tumor cell scattering, angiogenesis, and invasion.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Trefoil factor 3 antibody 23277-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Histotechnol Trefoil factor 3 knock-down prevents autophagy-related gene 12 elevation in colon adenocarcinoma.
| ||
Biomark Res Spatial resolved transcriptomics reveals distinct cross-talk between cancer cells and tumor-associated macrophages in intrahepatic cholangiocarcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Iru (Verified Customer) (06-21-2019) | There blot doesn't come out clean.
![]() |