Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

THOC7 Polyclonal antibody

THOC7 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

fSAP24, hTREX30, NIF3L1 binding protein 1, NIF3L1BP1, THO complex subunit 7 homolog, THOC7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for THOC7 in ?

Tested Applications

Positive WB detected inHeLa cells, human liver tissue, HEK-293 cells, mouse testis tissue, rat testis tissue
Positive IHC detected inhuman kidney tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17881-1-AP targets THOC7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11795

Product name: Recombinant human THOC7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-204 aa of BC065012

Sequence: MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP

Predict reactive species
Full Name THO complex 7 homolog (Drosophila)
Calculated Molecular Weight 204 aa, 24 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC065012
Gene Symbol THOC7
Gene ID (NCBI) 80145
RRIDAB_10548743
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6I9Y2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

THOC7 is a member of the THO complex that associate with the mRNA export apparatus. It is required for efficient export of polyadenylated RNA. It acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.

Protocols

Product Specific Protocols
IF protocol for THOC7 antibody 17881-1-APDownload protocol
IHC protocol for THOC7 antibody 17881-1-APDownload protocol
WB protocol for THOC7 antibody 17881-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The THOC7 Polyclonal antibody (Cat# 17881-1-AP) has 2 citations. One appears in International Journal of Biological Sciences (IF 11.7), studying PARP inhibitor vulnerability in hepatocellular carcinoma via THOC2-mediated mRNA export. The other is in Viruses (IF 3.8), investigating how Murine Leukemia Virus exploits TREX components for nuclear export of unspliced viral transcripts. Both citations use WB in human samples, covering research fields of cancer biology and virology.

SpeciesApplicationTitle
humanWB

Int J Biol Sci

Targeting THOC2-Mediated mRNA Export Induces PARP Inhibitor Vulnerability in DNA Repair-Competent Hepatocellular Carcinoma.

Authors - Xinli Li
humanWB

Viruses

Murine Leukemia Virus Uses TREX Components for Efficient Nuclear Export of Unspliced Viral Transcripts.

Authors - Toshie Sakuma
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...