• Featured Product
  • KD/KO Validated

TIM23 Polyclonal antibody

TIM23 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11123-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, IP, ELISA

TIMM23, Mitochondrial import inner membrane translocase subunit Tim23, TIMM 23

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, Jurkat cells, MCF-7 cells, mouse heart tissue, rat heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11123-1-AP targets TIM23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, monkey, bovine, hamster, megalobrama amblycephala
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1620

Product name: Recombinant human Tim23 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-208 aa of BC062707

Sequence: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFIPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

Predict reactive species
Full Name translocase of inner mitochondrial membrane 23
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC062707
Gene Symbol TIMM23
Gene ID (NCBI) 100287932
RRIDAB_615045
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14925
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIM23 is a mitochondrial inner membrane protein essential for import of preproteins into the matrix. Tim23 together with Tim17 and Tim44 form the Tim23 complex which mediates the import of nuclear encoded preproteins into the mitochondria. Tim23 is commonly used as loading control for mitochondrial inner membrane protein.

Protocols

Product Specific Protocols
IF protocol for TIM23 antibody 11123-1-APDownload protocol
IHC protocol for TIM23 antibody 11123-1-APDownload protocol
IP protocol for TIM23 antibody 11123-1-APDownload protocol
WB protocol for TIM23 antibody 11123-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nature

Cellular ATP demand creates metabolically distinct subpopulations of mitochondria

Authors - Keun Woo Ryu
mouseWB

Nature

CLSTN3β enforces adipocyte multilocularity to facilitate lipid utilization

Authors - Kevin Qian
mouseWB

Nature

The ADP/ATP translocase drives mitophagy independent of nucleotide exchange.

Authors - Atsushi Hoshino
humanWB

Nature

In vivo imaging of mitochondrial membrane potential in non-small-cell lung cancer.

Authors - Milica Momcilovic
humanWB

Signal Transduct Target Ther

Targeting CRL4 suppresses chemoresistant ovarian cancer growth by inducing mitophagy

Authors - Yang Meng
mouseWB

Cell

MicroRNA Directly Enhances Mitochondrial Translation during Muscle Differentiation.

Authors - Xiaorong Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Samuel (Verified Customer) (12-16-2025)

I found this TIM23 primary antibody to meet, (in the case of Western blotting), and exceed, (in the case of IHC), my expectations based on the results I was obtaining for this very same protein target using antibodies manufactured by competing brands. For instance, I would experience very faint Western blot banding with a competing antibody at the typical primary antibody concentration I use, (1:1000), and would only receive reasonable band intensity when I would increase my concentration to about 1:500 or so, (which would use up just a bit too much antibody, in my view). Additionally, I would experience a decent amount of non-specific banding, making it a bit more challenging to determine the correct banding pattern for the protein of interest. To reiterate, what I just mentioned was my experience testing this protein by Western using a competing primary antibody - with the Proteintech antibody I was able to dilute my primary antibody concentration to 1:2500 and that was more than sufficient to obtain a clean and intense Western banding pattern, along with practically zero non-specific banding. Lastly, my experience using this Proteintech antibody for my IHC experiment was fantastic - the staining I obtained was very clear and the intensity was to my liking, as well, given the antibody dilution I used. Overall, I rate this antibody very highly and would absolutely recommend it to others who are in need of an antibody targeting this protein.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:2500 (Western) & 1:500 (IHC)
FH

Wenhui (Verified Customer) (01-02-2025)

This antibody is good for detecting correct and clear band for WB with cardiac tissues and cardiomyocytes. I would have recommended it.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cardiac tissues and cardiomyocytes
FH

Angela (Verified Customer) (12-27-2024)

very good antibody , purchase many times!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: heart tissue
TIM23 Antibody Western Blot validation (1:1000 dilution) in heart tissue (Cat no:11123-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...