TIMP1 Polyclonal antibody

TIMP1 Polyclonal Antibody for IF, IHC, ELISA
Cat No. 10753-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

IHC, IF, ELISA

CLGI, Collagenase inhibitor, EPA, HCI, Metalloproteinase inhibitor 1, TIMP, TIMP 1, TIMP1, TIMP-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10753-1-AP targets TIMP1 in IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1146

Product name: Recombinant human TIMP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-169 aa of BC007097

Sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCL

Predict reactive species
Full Name TIMP metallopeptidase inhibitor 1
Calculated Molecular Weight 23 kDa
GenBank Accession NumberBC007097
Gene Symbol TIMP1
Gene ID (NCBI) 7076
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01033
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tissue Inhibitor of Metalloproteinases-1 (TIMP1) is a naturally occurring protein in the human organism regulating the activity of matrix metalloproteinases (MMPs). TIMP1 encodes a 931 base-pair mRNA and a 207 amino acid protein. Overexpression of TIMP1 can lead to a substantially increase of genes involved in proliferation, apoptosis and signal transduction. In addition, TIMP1 was found to decrease tumor cell sensitivity to multiple anticancer drugs by activation of downstream pathways and exhibited anti-apoptotic activity. Specifically, the TIMP1 could degrade cyclinB1 and activate the NF-kβ signaling pathway to protect breast cancer cells against chemotherapy-induced cell death.

Protocols

Product Specific Protocols
IF protocol for TIMP1 antibody 10753-1-APDownload protocol
IHC protocol for TIMP1 antibody 10753-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

Int J Biol Macromol

Anti-metastatic effects of antrodan, the Antrodia cinnamomea mycelia glycoprotein, in lung carcinoma cells.

Authors - Kuan-Ning Fa
humanIHC

Br J Pharmacol

Dual Inhibition of Cannabinoid-1 Receptor and iNOS Attenuates Obesity-induced Chronic Kidney Disease.

Authors - Shiran Udi
mouseIHC

Sci Rep

FOXO transcription factors protect against the diet-induced fatty liver disease.

Authors - Xiaoyan Pan

Cancer Cytopathol

A panel of protein markers for the early detection of lung cancer with bronchial brushing specimens.

Authors - Yi-Zhen Liu
mouse

Sci Rep

Quercetin prevents hepatic fibrosis by inhibiting hepatic stellate cell activation and reducing autophagy via the TGF-β1/Smads and PI3K/Akt pathways.

Authors - Liwei Wu
human

Mar Drugs

11-epi-Sinulariolide Acetate Reduces Cell Migration and Invasion of Human Hepatocellular Carcinoma by Reducing the Activation of ERK1/2, p38MAPK and FAK/PI3K/AKT/mTOR Signaling Pathways.

Authors - Jen-Jie Lin
Loading...
||
New chat Able
正在加载,请稍候...