Tested Applications
| Positive WB detected in | MCF-7 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24898-1-AP targets TMEM161A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18974 Product name: Recombinant human TMEM161A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 364-460 aa of BC005210 Sequence: VVRVYCYVTVVSLQYLTPLILTLNCTLLLKTLGGYSWGLGPAPLLSPDPSSASAAPIGSGEDEVQQTAARIAGALGGLLTPLFLRGVLAYLIWWTAA Predict reactive species |
| Full Name | transmembrane protein 161A |
| Calculated Molecular Weight | 479 aa, 54 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC005210 |
| Gene Symbol | TMEM161A |
| Gene ID (NCBI) | 54929 |
| RRID | AB_2879785 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NX61 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM161A also named as transmembrane protein 161A is a 479 amino acid protein which belongs to TMEM161 family. The molecular weight of TMEM161A is 56 kDa or 42 kDa. TMEM161A is a multi-pass membrane protein and localizes to the cell membrane. It may be involved in the negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and cellular response to oxidative stress.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TMEM161A antibody 24898-1-AP | Download protocol |
| WB protocol for TMEM161A antibody 24898-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









