Tested Applications
Positive WB detected in | A549 cells, human placenta tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
19825-1-AP targets TMEM176B in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13918 Product name: Recombinant human TMEM176B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 149-209 aa of BC004358 Sequence: SFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRAL Predict reactive species |
Full Name | transmembrane protein 176B |
Calculated Molecular Weight | 270 aa, 29 kDa |
Observed Molecular Weight | 31 kDa, 23 kDa |
GenBank Accession Number | BC004358 |
Gene Symbol | TMEM176B |
Gene ID (NCBI) | 28959 |
RRID | AB_10638313 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q3YBM2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM176B (also known as LR8) is a transmembrane protein belongs to the MS4A family of proteins. It may play a role in the process of maturation of dendritic cells. TMEM176B was first discovered in human lung fibroblasts and is associated with human small cell lung carcinoma. Studies suggest that TMEM176B might be involved in cancer and might serve as targets for antiangiogenic therapy of cancer patients (PMID: 24602018, 22244448). There are two isoforms produced by alternative splicing.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM176B antibody 19825-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Cell Targeting TMEM176B Enhances Antitumor Immunity and Augments the Efficacy of Immune Checkpoint Blockers by Unleashing Inflammasome Activation. | ||
Front Genet Comprehensive Analysis of Expression and Prognostic Value of MS4As in Glioma. |