Filter: AllWBIHCIF/ICC

WB analysis of mouse pancreas using 19207-1-AP
mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 19207-1-AP (TMEM27 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse kidney using 19207-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 19207-1-AP (TMEM27 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse kidney using 19207-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 19207-1-AP (TMEM27 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IHC staining of human kidney using 19207-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 19207-1-AP (TMEM27 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human kidney using 19207-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 19207-1-AP (TMEM27 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human liver cancer using 19207-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 19207-1-AP (TMEM27 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 19207-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 19207-1-AP (TMEM27 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HepG2 using 19207-1-AP
Immunofluorescent analysis of HepG2 cells, using TMEM27 antibody 19207-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

TMEM27 Polyclonal antibody

Name: TMEM27 Polyclonal antibody
Brand: Proteintech
SKU: 19207-1-AP

TMEM27 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 19207-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ACE2, CLTRN, Collectrin, NX 17, NX17, TMEM27, transmembrane protein 27

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse pancreas tissue, mouse kidney tissue
Positive IHC detected in	human kidney tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:100-1:400
Immunofluorescence (IF)/ICC	IF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19207-1-AP targets TMEM27 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7668 Product name: Recombinant human TMEM27 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-143 aa of BC050606 Sequence: VRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIW Predict reactive species
Full Name	transmembrane protein 27
Calculated Molecular Weight	25 kDa
Observed Molecular Weight	32 kDa
GenBank Accession Number	BC050606
Gene Symbol	TMEM27
Gene ID (NCBI)	57393
RRID	AB_10860104
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9HBJ8
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM27 (also termed collectrin), a 46 kDa type I transmembrane protein, is a homolog of the noncatalytic domain of angiotensin-converting enzyme-related carboxypeptidase (Ace2). Its expression has only been reported in the brush border membrane of the proximal tubules and collecting ducts of the kidney and in the pancreatic b cell (PMID: 11278314, 16330324). Overexpression of TMEM27 in b cells leads to increased proliferation in vitro and increased pancreatic b cell mass in vivo, and also has been reported to augment glucosestimulated ins secretion (GSIS) (PMID: 16330324, 16330323). The abundance of TMEM27 protein in b cells is furthermore regulated by ectodomain cleavage, which leads to two cleavage products, a 25 kDa N-terminal part that is released into the extracellular space (the shed fragment), and a 22 kDa C-terminal fragment (CTF) remaining in the membrane that is rapidly degraded (PMID: 16330324). TMEM27 is an N-glycosylated protein and can form dimers with MW of 64-75 kDa(patent US 20100119489 A1). TMEM27 can be used as a beta cell mass biomarker (PMID: 20386877, 21907142).

Protocols

Product Specific Protocols
WB protocol for TMEM27 antibody 19207-1-AP	Download protocol
IHC protocol for TMEM27 antibody 19207-1-AP	Download protocol
IF protocol for TMEM27 antibody 19207-1-AP	Download protocol