Tested Applications
| Positive WB detected in | HeLa cells, mouse heart tissue, A549 cells, HepG2 cells, MCF-7 cells, rat heart tissue |
| Positive IP detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IP | See 2 publications below |
Product Information
23992-1-AP targets TMEM55B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21172 Product name: Recombinant human TMEM55B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 15-83 aa of BC002867 Sequence: IDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVLPGEDPPPYSPLTSPDSGSAPMIT Predict reactive species |
| Full Name | transmembrane protein 55B |
| Calculated Molecular Weight | 277 aa, 29 kDa |
| Observed Molecular Weight | 29-32 kDa |
| GenBank Accession Number | BC002867 |
| Gene Symbol | TMEM55B |
| Gene ID (NCBI) | 90809 |
| RRID | AB_2879391 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86T03 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM55B is also named as C14orf9 and PIP4P1. TMEM55B is originally identified as phosphatidylinositol-4,5-P24-phosphatases (PtdIns-4,5-P24-phosphatases) that catalyze dephosphorylation of PtdIns-4,5-P2 to PtdIns-5-P. The transmembrane protein TMEM55B is involved in the perinuclear clustering of lysosomes upon starvation. TMEM55B expression is upregulated upon starvation via TFEB and TFE3 activation, and loss of TMEM55B diminishes starvation-induced lysosomal clustering. TMEM55B can bind to the dynein adaptor JIP4, promoting dynein-dynactin-dependent lysosomal trafficking to the perinuclear region. TMEM55B is also suggested to contribute to lysosomal homeostasis and mTORC1 activation via the V-ATPase assembly (PMID: 33537719).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for TMEM55B antibody 23992-1-AP | Download protocol |
| WB protocol for TMEM55B antibody 23992-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Protrudin and PDZD8 contribute to neuronal integrity by promoting lipid extraction required for endosome maturation.
| ||
JCI Insight TFEB-mediated lysosomal exocytosis alleviates high fat diet-induced lipotoxicity in the kidney | ||
Arterioscler Thromb Vasc Biol Phosphatidylinositol-(4,5)-Bisphosphate Regulates Plasma Cholesterol Through LDL (Low-Density Lipoprotein) Receptor Lysosomal Degradation.
| ||
Genes Cells TMEM55B contributes to lysosomal homeostasis and amino acid-induced mTORC1 activation.
| ||
J Cell Biol Tex2 is required for lysosomal functions at TMEM55-dependent ER membrane contact sites
| ||
EMBO J Longitudinal autophagy profiling of the mammalian brain reveals sustained mitophagy throughout healthy aging |









