Tested Applications
Positive WB detected in | IM-9 cells, K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21520-1-AP targets TNFRSF13B/CD267 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16097 Product name: Recombinant human TNFRSF13B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 133-247 aa of BC109392 Sequence: LVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA Predict reactive species |
Full Name | tumor necrosis factor receptor superfamily, member 13B |
Calculated Molecular Weight | 293 aa, 32 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC109392 |
Gene Symbol | TNFRSF13B/CD267 |
Gene ID (NCBI) | 23495 |
RRID | AB_10888631 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14836 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), also known as CD267 or TACI, is a transmembrane protein of the TNF receptor superfamily found predominantly on B cells (PMID: 10920230). TACI is also expressed on activated T cells, myeloma cells, and expressed by monocytes intracellularly at a low level (PMID: 11429548; 16825497). TNFRSF13B is a receptor for TNFSF13/APRIL/CD256 and TNFSF13B/BAFF/CD257 and mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-κB and AP-1 (PMID: 10956646; 10973284; 9311921). It is involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TNFRSF13B/CD267 antibody 21520-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |