Tested Applications
| Positive IHC detected in | human gliomas tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
15071-1-AP targets TOMM7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7105 Product name: Recombinant human TOMM7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC001732 Sequence: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG Predict reactive species |
| Full Name | translocase of outer mitochondrial membrane 7 homolog (yeast) |
| Calculated Molecular Weight | 6 kDa |
| Observed Molecular Weight | 6 kDa |
| GenBank Accession Number | BC001732 |
| Gene Symbol | TOMM7 |
| Gene ID (NCBI) | 54543 |
| RRID | AB_11232410 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9P0U1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TOMM7 antibody 15071-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neurochem Int Inhibition of PTEN-induced kinase 1 autophosphorylation may assist in preventing epileptogenesis induced by pentylenetetrazol
| ||
Sci Rep Attenuated PINK1 autophosphorylation play neuroprotective and anti-seizure roles in neonatal hypoxia | ||
Mol Biol Cell The receptor subunit Tom20 is dynamically associated with the TOM complex in mitochondria of human cells. | ||
Brain Res Bull Suppression of PINK1 autophosphorylation attenuates pilocarpine-induced seizures and neuronal injury in rats
| ||
Adv Sci (Weinh) SENP6 Maintains Mitochondrial Homeostasis by Regulating Mitochondrial Protein Import Through deSUMOylation of TOM40 |















