Tested Applications
Positive WB detected in | mouse heart tissue, rat heart tissue |
Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 2 publications below |
Product Information
23758-1-AP targets TPC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20607 Product name: Recombinant human TPCN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC136795 Sequence: MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSPSSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLME Predict reactive species |
Full Name | two pore segment channel 1 |
Calculated Molecular Weight | 816 aa, 94 kDa |
Observed Molecular Weight | 94 kDa |
GenBank Accession Number | BC136795 |
Gene Symbol | TPCN1 |
Gene ID (NCBI) | 53373 |
RRID | AB_2879317 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q9ULQ1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Two-pore channels (TPCs) are ancient members of the voltage-gated ion channel superfamily, are thought to be non-selective cation channels permeable to Ca2+. They mediate their physiological effects through releasing Ca2+ from acidic organelles in response to cues such as the second messenger, NAADP (nicotinic acid adenine dinucleotide phosphate). Genetic knockout and pharmacological inhibition experiments demonstrate that the two-pore channels, TPC1 and TPC2, are required for infection by Filoviruses Ebola and Marburg in mice.(PMID: 29746898; PMID 25722412) Two pore segment channel 1 (TPC1) is a human protein encoded by the TPCN1 gene.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TPC1 antibody 23758-1-AP | Download protocol |
IHC protocol for TPC1 antibody 23758-1-AP | Download protocol |
IF protocol for TPC1 antibody 23758-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Adv CLN7 is an organellar chloride channel regulating lysosomal function.
| ||
PLoS Pathog Pseudorabies virus inhibits progesterone-induced inactivation of TRPML1 to facilitate viral entry | ||
Phytomedicine Tetrandrine alleviates macrophage activation syndrome after CAR-T cell therapy
|