Tested Applications
| Positive WB detected in | K-562 cells, HeLa cells, Jurkat cells, PC-3 cells |
| Positive IP detected in | mouse pancreas tissue |
| Positive IHC detected in | mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
Product Information
12705-1-AP targets TRAM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3384 Product name: Recombinant human TRAM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 310-374 aa of BC037738 Sequence: FMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS Predict reactive species |
| Full Name | translocation associated membrane protein 1 |
| Calculated Molecular Weight | 374 aa, 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC037738 |
| Gene Symbol | TRAM1 |
| Gene ID (NCBI) | 23471 |
| RRID | AB_2282651 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15629 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRAM1 antibody 12705-1-AP | Download protocol |
| IP protocol for TRAM1 antibody 12705-1-AP | Download protocol |
| WB protocol for TRAM1 antibody 12705-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Pharmacol Achyranthes bidentata Polysaccharide Activates Nuclear Factor-Kappa B and Promotes Cytokine Production in J774A.1 Cells Through TLR4/MyD88 Signaling Pathway | ||
Evid Based Complement Alternat Med The Herbal Medicine Scutellaria-Coptis Alleviates Intestinal Mucosal Barrier Damage in Diabetic Rats by Inhibiting Inflammation and Modulating the Gut Microbiota. | ||
Front Endocrinol (Lausanne) Identification of immune-related endoplasmic reticulum stress genes in proliferative diabetic retinopathy using bioinformatics analysis | ||
Vet Microbiol Serum amyloid P component suppresses porcine epidemic diarrhea virus replication through TLR4-mediated IFN-β signaling pathway | ||
J Inflamm Res Circ_0001084/miR-181c-5p/PTPN4 Axis Mitigates Cardiomyocyte Injury by Modulating the TLR4/NF-κB Pathway: Insights into Therapeutic Potential for Myocardial Reperfusion Injury | ||
Mol Cell An ATP13A1-assisted topogenesis pathway for folding multi-spanning membrane proteins |











