• Featured Product
  • KD/KO Validated

TRIM21 Polyclonal antibody

This TRIM21 antibody (12108-1-AP) is a rabbit polyclonal antibody that targets TRIM21 in WB, IHC, IF/ICC, IP, ELISA and is suitable for human samples. The 12108-1-AP antibody has 99 publication citations.

Cat No. 12108-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IHC, IF/ICC, IP, coIP, ELISA

52 kDa ribonucleoprotein autoantigen Ro/SS-A, E3 ubiquitin-protein ligase TRIM21, EC:2.3.2.27, RING finger protein 81, RNF 81

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A549 cells, HeLa cells, HL-60 cells, HT-1080 cells, HT-29 cells, MCF-7 cells
Positive IP detected inHT-29 cells
Positive IHC detected inhuman pancreas cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, A549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12108-1-AP targets TRIM21 in WB, IHC, IF/ICC, IP, coIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2753

Product name: Recombinant human TRIM21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 176-475 aa of BC010861

Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY

Predict reactive species
Full Name tripartite motif-containing 21
Calculated Molecular Weight 475 aa, 54 kDa
Observed Molecular Weight 42-45 kDa, 49-54 kDa
GenBank Accession NumberBC010861
Gene Symbol TRIM21
Gene ID (NCBI) 6737
RRIDAB_2209469
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19474
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa.

Protocols

Product Specific Protocols
IF protocol for TRIM21 antibody 12108-1-APDownload protocol
IHC protocol for TRIM21 antibody 12108-1-APDownload protocol
IP protocol for TRIM21 antibody 12108-1-APDownload protocol
WB protocol for TRIM21 antibody 12108-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Blood

Platelet NLRP6 protects against microvascular thrombosis in sepsis

Authors - Huimin Jiang
humanIHC

J Clin Invest

The ubiquitin ligase TRIM21 regulates mutant p53 accumulation and gain-of-function in cancer

Authors - Juan Liu
humanWB,IP,IF

Nat Commun

Elaboration of molecular glues that target TRIM21 into TRIMTACs that degrade protein aggregates

Authors - Marc A Scemama de Gialluly
  • KD Validated
humanWB,IP

Adv Sci (Weinh)

SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma

Authors - Qifan Hu

Autophagy

KDM4A-induced tumor senescence enhances the efficacy of immunotherapy by inhibiting AGT-PHB1 axis-mediated mitophagy in colorectal cancer

Authors - Tanxing Cai
humanWB

Autophagy

Stress granule homeostasis is modulated by TRIM21-mediated ubiquitination of G3BP1 and autophagy-dependent elimination of stress granules

Authors - Cuiwei Yang
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

fei (Verified Customer) (10-02-2025)

this Ab is very good. I got strong and clear bands.

  • Applications: Western Blot, Immunoprecipitation, Cell culture
  • Cell Tissue Type: pancreatic beta cells
FH

Madison (Verified Customer) (05-28-2024)

The western blot showed very clear bands and had really precise staining. We got exactly what we wanted from the antibody on the first try

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Rippa Insoluble treated mouse cell
TRIM21 Antibody Western Blot validation (1:500 dilution) in Rippa Insoluble treated mouse cell (Cat no:12108-1-AP)
FH

Paul (Verified Customer) (01-14-2020)

Used routinely for Western Blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEKs
FH

Laura (Verified Customer) (01-14-2020)

Gives a clean Western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEK293T
FH

Benjamin (Verified Customer) (01-10-2020)

Used many times in many WB and IF applications. Reliably antibody which detects TRIM21 basal as well as fusion proteins in WB and can be used to visualise TRIM21 in cells through IF.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:500 WB, 1:200 IF
  • Cell Tissue Type: HEK, SHSY5Y
FH

Alinda (Verified Customer) (09-11-2019)

HEK were transfected with a TRIM21 overexpression vector- secondary anitbody used was rb Alexa 488.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: HEK-293T
TRIM21 Antibody Immunofluorescence, validation (1:200 dilution) in HEK-293T (Cat no:12108-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...