Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
26285-1-AP targets TRIM7 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23453 Product name: Recombinant human TRIM7 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 435-511 aa of BC132863 Sequence: LQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP Predict reactive species |
| Full Name | tripartite motif-containing 7 |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC132863 |
| Gene Symbol | TRIM7 |
| Gene ID (NCBI) | 81786 |
| RRID | AB_2880462 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9C029 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRIM7 antibody 26285-1-AP | Download protocol |
| WB protocol for TRIM7 antibody 26285-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Columbianadin targets TRIM7 to maintain P2X7 palmitoylation, inhibiting cuproptosis in synovial M2 macrophages | ||
EBioMedicine N6-Methyladenosine modification of the TRIM7 positively regulates tumorigenesis and chemoresistance in osteosarcoma through ubiquitination of BRMS1. | ||
J Virol Nascent Transcriptomics Reveal Cellular Prolytic Factors Upregulated Upstream of the Latent-to-Lytic Switch Protein of Epstein-Barr Virus.
| ||
Toxicol Res (Camb) Transcriptomic analysis reveals transcription factors implicated in radon-induced lung carcinogenesis | ||
Vet Microbiol TRIM7 inhibits encephalomyocarditis virus replication by activating interferon-β signaling pathway | ||
Sci Rep The E3 ligase TRIM7 suppresses the tumorigenesis of gastric cancer by targeting SLC7A11
|





