Tested Applications
Positive WB detected in | mouse heart tissue, rat heart tissue |
Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 5 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
CoIP | See 1 publications below |
Product Information
26285-1-AP targets TRIM7 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23453 Product name: Recombinant human TRIM7 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 435-511 aa of BC132863 Sequence: LQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP Predict reactive species |
Full Name | tripartite motif-containing 7 |
Observed Molecular Weight | 50-55 kDa |
GenBank Accession Number | BC132863 |
Gene Symbol | TRIM7 |
Gene ID (NCBI) | 81786 |
RRID | AB_2880462 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9C029 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TRIM7 antibody 26285-1-AP | Download protocol |
IHC protocol for TRIM7 antibody 26285-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
EBioMedicine N6-Methyladenosine modification of the TRIM7 positively regulates tumorigenesis and chemoresistance in osteosarcoma through ubiquitination of BRMS1. | ||
J Virol Nascent Transcriptomics Reveal Cellular Prolytic Factors Upregulated Upstream of the Latent-to-Lytic Switch Protein of Epstein-Barr Virus.
| ||
Vet Microbiol TRIM7 inhibits encephalomyocarditis virus replication by activating interferon-β signaling pathway | ||
Sci Rep The E3 ligase TRIM7 suppresses the tumorigenesis of gastric cancer by targeting SLC7A11
| ||
mBio The E3 ligase TRIM22 restricts SARS-CoV-2 replication by promoting proteasomal degradation of NSP8 | ||
Am J Pathol E3 Ubiquitin Ligase TRIM7 Alleviates LPS-Induced Acute Lung Injury via Inhibiting NLRP3 Inflammasome Activation |