TSHZ3 Polyclonal antibody

TSHZ3 Polyclonal Antibody for WB, ELISA
Cat No. 25018-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

KIAA1474, Teashirt homolog 3, TSH3, TSHZ3, Zinc finger protein 537, ZNF537

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse uterus tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25018-1-AP targets TSHZ3 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18953

Product name: Recombinant human TSHZ3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 395-524 aa of BC127095

Sequence: GNSEIVSPTKNQTLVSPPSSQTSPMPKTNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTA

Predict reactive species
Full Name teashirt zinc finger homeobox 3
Calculated Molecular Weight 1081 aa, 119 kDa
Observed Molecular Weight 105-120 kDa
GenBank Accession NumberBC127095
Gene Symbol TSHZ3
Gene ID (NCBI) 57616
RRIDAB_2879849
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ63HK5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TSHZ3 is a transcriptional regulator involved in developmental processes. TSHZ3 regulates the development of neurons involved in both respiratory rhythm and airflow control. Recent research has shown that it is also involved in vocal learning.

Protocols

Product Specific Protocols
WB protocol for TSHZ3 antibody 25018-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...