Tested Applications
| Positive IHC detected in | human kidney tissue, human testis tissue, human spleen tissue, human lung tissue, human ovary tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 10 publications below |
Product Information
13778-1-AP targets TSLP in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4771 Product name: Recombinant human TSLP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-159 aa of BC016720 Sequence: IQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species |
| Full Name | thymic stromal lymphopoietin |
| Calculated Molecular Weight | 15 kDa, 42 kDa |
| GenBank Accession Number | BC016720 |
| Gene Symbol | TSLP |
| Gene ID (NCBI) | 85480 |
| RRID | AB_2208528 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q969D9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TSLP antibody 13778-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Invest Dermatol Retracing from Outcomes to Causes: NRF2-Driven GSTA4 Transcriptional Regulation Controls Chronic Inflammation and Oxidative Stress in Atopic Dermatitis Recurrence | ||
Int Immunopharmacol Hypoxia induces the production of epithelial-derived cytokines in eosinophilic chronic rhinosinusitis with nasal polyps | ||
Am J Physiol Renal Physiol Ubiquitination of NKCC2 by the Cullin-RING E3 Ubiquitin Ligase Family in the Rat Thick Ascending Limb of the Loop of Henle | ||
Br J Dermatol Elevations in Th2-initiating cytokines (IL-33, IL-25, TSLP) in lesional skin from Chronic Spontaneous ("Idiopathic") Urticaria. | ||
J Immunol Res Thymic Stromal Lymphopoietin Is Implicated in the Pathogenesis of Bullous Pemphigoid by Dendritic Cells. | ||
Cell Syst A digital CRISPR-dCas9-based gene remodeling biocomputer programmed by dietary compounds in mammals |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Becky (Verified Customer) (07-30-2018) | It would be great to have this ab stable at 4C. I only use 1uL at a time for ELISA, and storage is -20.
|























