Tested Applications
Positive WB detected in | mouse lung tissue |
Positive IP detected in | mouse lung tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
13570-1-AP targets TSPAN13 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4464 Product name: Recombinant human TSPAN13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 100-204 aa of BC033863 Sequence: NQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL Predict reactive species |
Full Name | tetraspanin 13 |
Calculated Molecular Weight | 204 aa, 22 kDa |
Observed Molecular Weight | 28-35 kDa |
GenBank Accession Number | BC033863 |
Gene Symbol | TSPAN13 |
Gene ID (NCBI) | 27075 |
RRID | AB_10597858 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95857 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TSPAN13 (also known as NET6 or TM4SF13) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. Overexpression of TSPAN13 has been reported in prostate cancer, suggesting that TSPAN13 may have an important role in the progression of prostate cancer (PMID: 19148481). TSPAN13 has a calcular molecular weight of 22 kDa. This polyclonal antibody is raised against 100-204aa of human TSPAN13. The experimentally determined molecular mass of 28-35 kDa is larger than the calculated molecular mass, which could be a result of post-translational modifications (PMID: 23648579).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TSPAN13 antibody 13570-1-AP | Download protocol |
IP protocol for TSPAN13 antibody 13570-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jerome (Verified Customer) (07-08-2020) | Sign background, unclear if specific.
![]() |