Tested Applications
Positive WB detected in | mouse lung tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
18974-1-AP targets TSPAN13 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6997 Product name: Recombinant human TSPAN13 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 100-204 aa of BC033863 Sequence: NQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL Predict reactive species |
Full Name | tetraspanin 13 |
Calculated Molecular Weight | 204 aa, 22 kDa |
Observed Molecular Weight | 28-35 kDa |
GenBank Accession Number | BC033863 |
Gene Symbol | TSPAN13 |
Gene ID (NCBI) | 27075 |
RRID | AB_10596633 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95857 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TSPAN13 antibody 18974-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |