Tested Applications
Positive WB detected in | human brain tissue, human plasma tissue |
Positive IHC detected in | human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
14329-1-AP targets TSPAN33 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5597 Product name: Recombinant human TSPAN33 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 116-236 aa of BC044244 Sequence: FVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNL Predict reactive species |
Full Name | tetraspanin 33 |
Calculated Molecular Weight | 32 kDa |
Observed Molecular Weight | 64-72 kDa |
GenBank Accession Number | BC044244 |
Gene Symbol | TSPAN33 |
Gene ID (NCBI) | 340348 |
RRID | AB_10644331 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86UF1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TSPAN33 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN33 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN14, TSPAN15, and TSPAN17. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TSPAN33 antibody 14329-1-AP | Download protocol |
IHC protocol for TSPAN33 antibody 14329-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |