Filter: AllWBIPIHC

WB analysis of Jurkat using 25443-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis using 25443-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
WB analysis of mouse spleen using 25443-1-AP
mouse spleen tissue were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of SKOV-3 using 25443-1-AP
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of human placenta using 25443-1-AP
human placenta tissue were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of PC-3 using 25443-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of mouse heart using 25443-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of K-562 using 25443-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of MCF-7 using 25443-1-AP
MCF-7 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of NIH/3T3 using 25443-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
IP experiment of mouse heart using 25443-1-AP
IP result of anti-TTC35 (IP:25443-1-AP, 3ug; Detection:25443-1-AP 1:600) with mouse heart tissue lysate 4000ug.
IHC staining of human ovary cancer using 25443-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

TTC35 Polyclonal antibody

Name: TTC35 Polyclonal antibody
Brand: Proteintech
SKU: 25443-1-AP

TTC35 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 25443-1-AP

Publications(15)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EMC2, ER membrane protein complex subunit 2, KIAA0103, TPR repeat protein 35

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (15)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Jurkat cells, mouse heart tissue, K-562 cells, MCF-7 cells, NIH/3T3 cells, mouse spleen tissue, human placenta tissue, PC-3 cells, SKOV-3 cells
Positive IP detected in	mouse heart tissue
Positive IHC detected in	human ovary cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 14 publications below
IF	See 1 publications below
IP	See 1 publications below

Product Information

25443-1-AP targets TTC35 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22196 Product name: Recombinant human TTC35 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-297 aa of BC021667 Sequence: MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS Predict reactive species
Full Name	tetratricopeptide repeat domain 35
Calculated Molecular Weight	297 aa, 35 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC021667
Gene Symbol	TTC35
Gene ID (NCBI)	9694
RRID	AB_2750836
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15006
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TPR repeat protein 35 (TTC35), also named as tetratricopeptide repeat domain 35, is a 297 amino acid protein, which contains three TPR repeats and belongs to the EMC2 family. TTC35 localizes in the nucleus and cytoplasm. TTC35 is a component of the ER membrane protein complex and may be a putative O-linked glycosyl transferase.

Protocols

Product Specific Protocols
IHC protocol for TTC35 antibody 25443-1-AP	Download protocol
IP protocol for TTC35 antibody 25443-1-AP	Download protocol
WB protocol for TTC35 antibody 25443-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Cell EMC Is Required to Initiate Accurate Membrane Protein Topogenesis. Authors - Patrick J Chitwood View Article
human	WB	Mol Cell WNK1 is an assembly factor for the human ER membrane protein complex. Authors - Tino Pleiner View Article
human	WB	EMBO Mol Med SLC25A46 is required for mitochondrial lipid homeostasis and cristae maintenance and is responsible for Leigh syndrome. Authors - Alexandre Janer View Article
human	WB	J Cell Biol A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER Authors - Tino Pleiner View Article
human	WB	Elife The ER membrane protein complex is required to ensure correct topology and stable expression of flavivirus polyproteins. Authors - Ashley M Ngo View Article
human	WB	Elife Structural and mechanistic basis of the EMC-dependent biogenesis of distinct transmembrane clients. Authors - Lakshmi E Miller-Vedam KO Validated View Article