• Featured Product
  • KD/KO Validated

TXNRD1 Polyclonal antibody

TXNRD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11117-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

TRXR1, GRIM12, GRIM 12, Gene associated with retinoic and interferon-induced mortality 12 protein, Gene associated with retinoic and IFN-induced mortality 12 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, Jurkat cells, mouse heart tissue, rat heart tissue
Positive IHC detected inhuman testis tissue, human breast cancer tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:3000-1:10000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11117-1-AP targets TXNRD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1618

Product name: Recombinant human TXNRD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 199-500 aa of BC018122

Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG

Predict reactive species
Full Name thioredoxin reductase 1
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC018122
Gene Symbol TXNRD1
Gene ID (NCBI) 7296
RRIDAB_2210113
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16881
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310)

Protocols

Product Specific Protocols
FC protocol for TXNRD1 antibody 11117-1-APDownload protocol
IF protocol for TXNRD1 antibody 11117-1-APDownload protocol
IHC protocol for TXNRD1 antibody 11117-1-APDownload protocol
WB protocol for TXNRD1 antibody 11117-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Redox Biol

Fast regulation of the NF-κB signalling pathway in human skeletal muscle revealed by high-intensity exercise and ischaemia at exhaustion: Role of oxygenation and metabolite accumulation.

Authors - Angel Gallego-Selles
human,mouseWB

J Immunother Cancer

Nanoparticle delivery of miR-21-3p sensitizes melanoma to anti-PD-1 immunotherapy by promoting ferroptosis.

Authors - Weinan Guo
humanWB

Cell Death Dis

Elovanoid-N34 modulates TXNRD1 key in protection against oxidative stress-related diseases

Authors - Jorgelina M Calandria
humanWB

Cancer Res

Natural allelic variations in glutathione peroxidase-1 affect it subcellular localization and function.

Authors - Soumen Bera
ratWB

Nucleic Acids Res

Nucleolin binds to a subset of selenoprotein mRNAs and regulates their expression.

Authors - Miniard Angela C AC
humanWB

Free Radic Biol Med

Honokiol protects against heavy-ion radiation-induced oxidative damage via the thioredoxin system

Authors - Yaxiong Chen
Loading...
||
New chat Able
正在加载,请稍候...