Tested Applications
| Positive IHC detected in | mouse liver tissue, human lung cancer tissue, human urothelial carcinoma tissue, mouse stomach tissue, rat liver tissue, rat pancreas tissue, rat stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
Product Information
10457-1-AP targets UBC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0711 Product name: Recombinant human UBC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-265 aa of BC008955 Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE Predict reactive species |
| Full Name | ubiquitin C |
| Calculated Molecular Weight | 60 kDa |
| GenBank Accession Number | BC008955 |
| Gene Symbol | UBC |
| Gene ID (NCBI) | 7316 |
| RRID | AB_2241301 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P0CG48 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin (Ub) is a small, highly conserved eukaryotic protein that has an essential role in diverse cellular signaling pathways, including targeting proteins for proteasomal degradation. Cellular Ub is comprised of two distinct pools consisting of free Ub and Ub-substrate conjugates. UbC is a polyubiquitine gene that encodes Ub polyprotein. UbC, as stress-inducible polyubiquitin precursor proteins of around 9-11 monomers, is cleaved into monomeric ubiquitin by cellular deubiquitylating enzymes.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UBC antibody 10457-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS One Ubiquitin B in cervical cancer: critical for the maintenance of cancer stem-like cell characters.
| ||
Chem Biol Interact Proteomic analysis of apoptosis induction by lariciresinol in human HepG2 cells. | ||
Neuroscience Maresin 1 Activates LGR6 to Alleviate Neuroinflammation via the CREB/JMJD3/IRF4 Pathway in a Rat Model of Subarachnoid Hemorrhage |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH wei (Verified Customer) (07-24-2025) | USED WORK WELL
|





















