Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells, HEK-293 cells, mouse spleen tissue, rat spleen tissue, mouse colon tissue |
| Positive IHC detected in | human colon cancer tissue, human normal colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15912-1-AP targets UBE1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8703 Product name: Recombinant human UBE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 711-1058 aa of BC013041 Sequence: CHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR Predict reactive species |
| Full Name | ubiquitin-like modifier activating enzyme 1 |
| Calculated Molecular Weight | 1058 aa, 118 kDa |
| Observed Molecular Weight | 114-118 kDa |
| GenBank Accession Number | BC013041 |
| Gene Symbol | UBA1 |
| Gene ID (NCBI) | 7317 |
| RRID | AB_2211462 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22314 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UBE1(Ubiquitin-activating enzyme E1) is also named as A1S9T, UBE1 and belongs to the ubiquitin-activating E1 family. It catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation and initiates the activation and conjugation of ubiquitin-like proteins. Defects in UBE1 are the cause of spinal muscular atrophy X-linked type 2 (SMAX2). UBE1 has two isoforms with the molecular mass of 118 and 114 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UBE1 antibody 15912-1-AP | Download protocol |
| WB protocol for UBE1 antibody 15912-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
UBE1 Polyclonal antibody (Cat# 15912-1-AP) has 17 citations across journals including Cell Research, Cancer Discovery, Nature Communications, ACS Nano, Cell Reports, Journal of Biological Chemistry, International Immunopharmacology, Molecular Neurobiology, Journal of Molecular Medicine, iScience, Frontiers in Oncology, Journal of Proteomics, American Journal of Cancer Research, Analytica Chimica Acta, Cancer Biology & Medicine, and bioRxiv. Research fields span cancer immunology, ubiquitin-mediated protein degradation, neurodegeneration, virology, proteomics, and biochemistry.
| Species | Application | Title |
|---|---|---|
Cell Res Tumor PD-L1 induces β2m ubiquitylation and degradation for cancer cell immune evasion. | ||
Cancer Discov The UBA1-STUB1 axis mediates cancer immune escape and resistance to checkpoint blockade | ||
Nat Commun HIV-1 promotes ubiquitination of the amyloidogenic C-terminal fragment of APP to support viral replication
| ||
Nat Commun DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation | ||
ACS Nano Graphene Oxide Causes Disordered Zonation Due to Differential Intralobular Localization in the Liver. | ||
Cancer Biol Med CSN6 promotes tumorigenesis of gastric cancer by ubiquitin-independent proteasomal degradation of p16INK4a. |
Reviews
What customers say
All three reviewers gave this antibody a perfect 5-star rating for Western Blot. Users consistently report clean bands with no background at a 1:1000 dilution. The antibody successfully detects Ube1 at the expected molecular weight across multiple cell lines, including HEK293T, Calu3, mESCs, VeroE6, and A549. One reviewer highlighted that the working dilution can be reused many times, adding to its cost-effectiveness. Overall, users describe it as a reliable and high-performance reagent for endogenous Ube1 detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christine (Verified Customer) (06-01-2026) | Detects 2 bands (close to each other) a bit above 100 kDa in untransfected HEK293T cells. No background, beautiful antibody for the detection of endogenous Ube1.
|
RuthMabel (Verified Customer) (10-03-2025) | Works beautifully for WB, very clean and no background bands. Used at 1:1000 dilution in BSA, and can re-use the dilution many times. Have also used for lysates from VeroE6, 293T, and A549 cells.
 |
Tsimafei (Verified Customer) (11-19-2024) | Antibody detect a band of the expected molecular weight in mESCs
 |
